SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariASG10174_complete:A_SariASG_c35207_g1_i2
Scaffold_id
NCBI non-redundant
(nr)
beta-TrCP_isoform_X1_[Bombyx_mori]
Ontology
GO:0000086 P G2/M transition of mitotic cell cycle
GO:0000209 P protein polyubiquitination
GO:0002223 P stimulatory C-type lectin receptor signaling pathway
GO:0004842 F ubiquitin-protein transferase activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0006470 P protein dephosphorylation
GO:0006511 P ubiquitin-dependent protein catabolic process
GO:0007165 P signal transduction
GO:0008013 F beta-catenin binding
GO:0016032 P viral process
GO:0016055 P Wnt signaling pathway
GO:0016567 P protein ubiquitination
GO:0016874 F ligase activity
GO:0019005 C SCF ubiquitin ligase complex
GO:0030163 P protein catabolic process
GO:0031146 P SCF-dependent proteasomal ubiquitin-dependent protein catabolic process
GO:0031648 P protein destabilization
GO:0033598 P mammary gland epithelial cell proliferation
GO:0038061 P NIK/NF-kappaB signaling
GO:0038095 P Fc-epsilon receptor signaling pathway
GO:0042752 P regulation of circadian rhythm
GO:0042753 P positive regulation of circadian rhythm
GO:0043122 P regulation of I-kappaB kinase/NF-kappaB signaling
GO:0043161 P proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0043433 P negative regulation of DNA-binding transcription factor activity
GO:0045309 F protein phosphorylated amino acid binding
GO:0045862 P positive regulation of proteolysis
GO:0045879 P negative regulation of smoothened signaling pathway
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0046983 F protein dimerization activity
GO:0048511 P rhythmic process
GO:0050852 P T cell receptor signaling pathway
GO:0051403 P stress-activated MAPK cascade
GO:0051437 P obsolete positive regulation of ubiquitin-protein ligase activity involved in regulation of mitotic cell cycle transition
GO:0051726 P regulation of cell cycle
GO:0060444 P branching involved in mammary gland duct morphogenesis
GO:0060828 P regulation of canonical Wnt signaling pathway
GO:0061136 P regulation of proteasomal protein catabolic process
GO:0061630 F ubiquitin protein ligase activity
GO:0071407 P cellular response to organic cyclic compound
RNA-seq EntryA_SariASG_c35207_g1_i2
Sequence
(Amino Acid)
METEWTIEDIMPPQQVTSLTSLDSGVRPLPSSPAYTAERDACLNYFSRWNETDQVEFVEQ
LLARMCHYQHGHINAYLKPMLQRDFISMLPKKGLDHVAENILSYLDASSLCAAELVCREW
LRVISEGMLWKKLIERKVRTDSLWRGLAERRGWIQYLFKPKPGCQHPSHSFYRQLYPKII
KDIQSIEDNWRMGKHNLQRINCRSENSKGVYCLQYDDNKIVSGLRDNTIKIWDRKTLQCV
RELQGHTGSVLCLQYDERAIISGSSDSTVRVWDVNTGVMLNTLIHHCEAVLHLRFCNGMM
VTCSKDRSIAVWDMTSTTEIMLRRVLVGHRAAVNVVDFDEKYIVSASGDRTIKVWNTSSC
EFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGSCIRVLEGHEELVRCIRFDN
KRIVSGAYDGKIKVWDLPAALDVRTPHQDLCLRTLVEHTGRVFRLQFDEFQIVSSSHDDT
ILVWDFLNYGSGSPAPSHPPAHPRPRTPDRDRSYD
*(171 a.a.)

- SilkBase 1999-2023 -