SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariASG10120_complete:A_SariASG_c35160_g1_i2
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_large_proline-rich_protein_BAG6_[Amyelois_transitella]
Ontology
GO:0001822 P kidney development
GO:0002376 P immune system process
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0006511 P ubiquitin-dependent protein catabolic process
GO:0006810 P transport
GO:0006915 P apoptotic process
GO:0007130 P synaptonemal complex assembly
GO:0007283 P spermatogenesis
GO:0007420 P brain development
GO:0009790 P embryo development
GO:0016020 C membrane
GO:0016568 P chromatin organization
GO:0018393 P internal peptidyl-lysine acetylation
GO:0030154 P cell differentiation
GO:0030324 P lung development
GO:0030544 F Hsp70 protein binding
GO:0031593 F polyubiquitin modification-dependent protein binding
GO:0031625 F ubiquitin protein ligase binding
GO:0032435 P negative regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0042127 P regulation of cell population proliferation
GO:0042771 P intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
GO:0042981 P regulation of apoptotic process
GO:0043022 F ribosome binding
GO:0043066 P negative regulation of apoptotic process
GO:0043231 C intracellular membrane-bounded organelle
GO:0045861 P negative regulation of proteolysis
GO:0050821 P protein stabilization
GO:0051787 F misfolded protein binding
GO:0070059 P intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress
GO:0070628 F proteasome binding
GO:0071816 P tail-anchored membrane protein insertion into ER membrane
GO:0071818 C BAT3 complex
GO:1904294 P positive regulation of ERAD pathway
GO:1904378 P maintenance of unfolded protein involved in ERAD pathway
GO:1904379 P protein localization to cytosolic proteasome complex involved in ERAD pathway
GO:1990381 F ubiquitin-specific protease binding
RNA-seq EntryA_SariASG_c35160_g1_i2
Sequence
(Amino Acid)
MIMQHWSEEWVPVISNDQQAQNADPQEPYSDAYLSGMPAKKRRCLHQTRPPTTLDGFMNE
SAREAVSCTSPVEDNSVLRSAFREHMRNLARDRSTESEDYDPLRYASAARFIGSPIVESH
SSETNDEKNDN
*(43 a.a.)

- SilkBase 1999-2023 -