SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_ErmoMG23033_internal:A_ErmoMG_comp174559_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)		putative_cop9_signalosome_complex_subunit_[Danaus_plexippus]
Ontology
GO:0003714 F transcription corepressor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0006909 P phagocytosis
GO:0007095 P mitotic G2 DNA damage checkpoint signaling
GO:0007275 P multicellular organism development
GO:0007281 P germ cell development
GO:0008180 C COP9 signalosome
GO:0008231 C repressor ecdysone receptor complex
GO:0010388 P protein deneddylation
GO:0016922 F nuclear receptor binding
GO:0022008 P neurogenesis
GO:0030154 P cell differentiation
GO:0035257 F nuclear receptor binding
GO:0036099 P female germ-line stem cell population maintenance
GO:0042803 F protein homodimerization activity
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0048140 P male germ-line cyst encapsulation
GO:0048142 P germarium-derived cystoblast division
GO:0048477 P oogenesis
GO:0050821 P protein stabilization
GO:0051726 P regulation of cell cycle
RNA-seq EntryA_ErmoMG_comp174559_c0_seq1
Sequence
(Amino Acid)
DYGLEYSEDSNSEPDVDLENQYYNSKALKEDVPHEALLSFQKVLELEGGDKGEWGFKALK
QMIKINFKLSNFTEMMARYKQLLTYIKSAVTRNHSEKSINSILDYISTSRNMELLQDFYE
TTLE
(40 a.a.)

- SilkBase 1999-2023 -