SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_ErmoMG23004_3prime_partial:A_ErmoMG_comp168657_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_nuclear_pore_complex_protein_Nup50_[Bombyx_mori]
Ontology
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005643 C nuclear pore
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0006406 P mRNA export from nucleus
GO:0006409 P tRNA export from nucleus
GO:0006606 P protein import into nucleus
GO:0006810 P transport
GO:0007077 P mitotic nuclear membrane disassembly
GO:0008536 F small GTPase binding
GO:0010827 P regulation of glucose transmembrane transport
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016032 P viral process
GO:0016925 P protein sumoylation
GO:0019083 P viral transcription
GO:0031047 P gene silencing by RNA
GO:0031965 C nuclear membrane
GO:0046907 P intracellular transport
GO:0051028 P mRNA transport
GO:0075733 P intracellular transport of virus
GO:1900034 P regulation of cellular response to heat
RNA-seq EntryA_ErmoMG_comp168657_c0_seq1
Sequence
(Amino Acid)
MSVKRQATTDLNHENWDQEDPEENKEMGSFKAASKEILEKRVIKTAKRRTLAAPEEASKT
QELFSNLGGFNKTSTSFDFLANLTKDNKNSKTSTNTEPSGLFSNKLPSNSSTPL
(37 a.a.)

- SilkBase 1999-2023 -