SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_ErmoMG22963_internal:A_ErmoMG_comp159045_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)		E3_ubiquitin-protein_ligase_SMURF2_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000151 C ubiquitin ligase complex
GO:0000209 P protein polyubiquitination
GO:0004842 F ubiquitin-protein transferase activity
GO:0005160 F transforming growth factor beta receptor binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0006511 P ubiquitin-dependent protein catabolic process
GO:0016020 C membrane
GO:0016567 P protein ubiquitination
GO:0016874 F ligase activity
GO:0017015 P regulation of transforming growth factor beta receptor signaling pathway
GO:0030509 P BMP signaling pathway
GO:0030512 P negative regulation of transforming growth factor beta receptor signaling pathway
GO:0030579 P ubiquitin-dependent SMAD protein catabolic process
GO:0042787 P ubiquitin-dependent protein catabolic process
GO:0042802 F identical protein binding
GO:0045121 C membrane raft
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0046332 F SMAD binding
GO:0060071 P Wnt signaling pathway, planar cell polarity pathway
GO:0061630 F ubiquitin protein ligase activity
GO:0090263 P positive regulation of canonical Wnt signaling pathway
GO:1901165 P positive regulation of trophoblast cell migration
RNA-seq EntryA_ErmoMG_comp159045_c0_seq1
Sequence
(Amino Acid)
RIIMSIPFKISVDGSGQVYSTNTVKATLDPKWNTHYDLYLSKGDGITISVWNQRKVHKRQ
GSGFLGCVRIQPSTVHKLKDTGYQCLELCEDGQSGETCGVKGQVIISLMSRDSTRGEPAS
AAGEGSPLAVVGPAGEVRPPREPVVSPNPSQLSLPPHWEERFTSSGRPYYVNHATRRTQW
ERPTSESSESPSPPTSPALVPSTPTSPTLTSAPSSPGSDTDVNPATSISLRPEPQPQTAV
RRQQANSSPPTTPSSPVTTPTTPVAAAPISATDLPPGYEMRTTGQGQVYFYNSATG
(97 a.a.)

- SilkBase 1999-2023 -