SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_ErmoMG22819_5prime_partial:A_ErmoMG_comp124278_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_aspartyl/asparaginyl_beta-hydroxylase_isoform_X7_[Bombyx_mori]
Ontology
GO:0004597 F peptidyl-aspartic acid 3-dioxygenase activity
GO:0005509 F calcium ion binding
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0005886 C plasma membrane
GO:0007389 P pattern specification process
GO:0008285 P negative regulation of cell population proliferation
GO:0010524 P positive regulation of calcium ion transport into cytosol
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016491 F oxidoreductase activity
GO:0016529 C sarcoplasmic reticulum
GO:0018193 P peptidyl-amino acid modification
GO:0030176 C integral component of endoplasmic reticulum membrane
GO:0031585 P regulation of inositol 1,4,5-trisphosphate-sensitive calcium-release channel activity
GO:0031647 P regulation of protein stability
GO:0032237 P activation of store-operated calcium channel activity
GO:0032541 C cortical endoplasmic reticulum
GO:0033017 C sarcoplasmic reticulum membrane
GO:0033198 P response to ATP
GO:0035108 P limb morphogenesis
GO:0042264 P peptidyl-aspartic acid hydroxylation
GO:0045862 P positive regulation of proteolysis
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0046872 F metal ion binding
GO:0051213 F dioxygenase activity
GO:0055114 P obsolete oxidation-reduction process
GO:0060021 P roof of mouth development
GO:0060325 P face morphogenesis
GO:0070588 P calcium ion transmembrane transport
GO:0071277 P cellular response to calcium ion
GO:0090316 P positive regulation of intracellular protein transport
GO:0097202 P activation of cysteine-type endopeptidase activity
GO:1901879 P regulation of protein depolymerization
RNA-seq EntryA_ErmoMG_comp124278_c0_seq1
Sequence
(Amino Acid)
LLLLGRFEEAHEVHKRGAALGHFLSPNQRSLYNVERLKSKPWWDIDKTPYMKLARALERS
WKQILEEGENMRALYEQEKEGLKERGEWSQLDLFVRGAEIPGRCKKAPVTCSIVRQEAAA
AGCRRGQIKFSAMEAGTHVRPHVGPTNCRLRMHLGLTNTKDTYIRVDKETRQWQKGKVFM
FDDSFEHEVWHNGTGTRLVLIVDVWHPDLTHAERRQLPAI
*(72 a.a.)

- SilkBase 1999-2023 -