SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_ErmoMG22805_internal:A_ErmoMG_comp118132_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_E3_ubiquitin-protein_ligase_hrd-like_protein_1_[Amyelois_transitella]
Ontology
GO:0000209 P protein polyubiquitination
GO:0000838 C Hrd1p ubiquitin ligase ERAD-M complex
GO:0004842 F ubiquitin-protein transferase activity
GO:0004872 F signaling receptor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0006511 P ubiquitin-dependent protein catabolic process
GO:0006928 P movement of cell or subcellular component
GO:0007165 P signal transduction
GO:0007568 P aging
GO:0007611 P learning or memory
GO:0008270 F zinc ion binding
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016567 P protein ubiquitination
GO:0016874 F ligase activity
GO:0030176 C integral component of endoplasmic reticulum membrane
GO:0030425 C dendrite
GO:0030426 C growth cone
GO:0030433 P ubiquitin-dependent ERAD pathway
GO:0030674 F protein-macromolecule adaptor activity
GO:0030968 P endoplasmic reticulum unfolded protein response
GO:0032092 P positive regulation of protein binding
GO:0034450 F ubiquitin-ubiquitin ligase activity
GO:0036503 P ERAD pathway
GO:0036513 C Derlin-1 retrotranslocation complex
GO:0042787 P ubiquitin-dependent protein catabolic process
GO:0043025 C neuronal cell body
GO:0043234 C protein-containing complex
GO:0046872 F metal ion binding
GO:0048471 C perinuclear region of cytoplasm
GO:0051087 F chaperone binding
GO:0051259 P protein complex oligomerization
GO:0051865 P protein autoubiquitination
GO:0061630 F ubiquitin protein ligase activity
GO:0070936 P protein K48-linked ubiquitination
GO:1904264 F ubiquitin protein ligase activity
GO:1904288 F BAT3 complex binding
GO:1990381 F ubiquitin-specific protease binding
RNA-seq EntryA_ErmoMG_comp118132_c0_seq1
Sequence
(Amino Acid)
AAPPAAPAPARHLLLMPPQNHLFHFDGSRYVSWLPSFSVEVTRARVSSAQLDAMQAQVLA
MFPQAEPAAVRADLALTRSAHLTLDNILEGRLQPPPPPPP
(32 a.a.)

- SilkBase 1999-2023 -