SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_ErmoMG1818_internal:A_ErmoMG_comp21468_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)		Inositol_1,4,5-trisphosphate_receptor_[Papilio_machaon]
Ontology
GO:0005216 F ion channel activity
GO:0005220 F inositol 1,4,5-trisphosphate-sensitive calcium-release channel activity
GO:0005262 F calcium channel activity
GO:0005515 F protein binding
GO:0005635 C nuclear envelope
GO:0005737 C cytoplasm
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0005886 C plasma membrane
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006816 P calcium ion transport
GO:0006915 P apoptotic process
GO:0007165 P signal transduction
GO:0007202 P activation of phospholipase C activity
GO:0007204 P positive regulation of cytosolic calcium ion concentration
GO:0007223 P Wnt signaling pathway, calcium modulating pathway
GO:0008022 F protein C-terminus binding
GO:0014069 C postsynaptic density
GO:0015278 F calcium-release channel activity
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016529 C sarcoplasmic reticulum
GO:0019903 F protein phosphatase binding
GO:0030425 C dendrite
GO:0030667 C secretory granule membrane
GO:0032403 F protein-containing complex binding
GO:0035091 F phosphatidylinositol binding
GO:0038095 P Fc-epsilon receptor signaling pathway
GO:0038096 P Fc-gamma receptor signaling pathway involved in phagocytosis
GO:0043025 C neuronal cell body
GO:0043231 C intracellular membrane-bounded organelle
GO:0043234 C protein-containing complex
GO:0045121 C membrane raft
GO:0048016 P inositol phosphate-mediated signaling
GO:0048471 C perinuclear region of cytoplasm
GO:0050796 P regulation of insulin secretion
GO:0051209 P release of sequestered calcium ion into cytosol
GO:0051928 P positive regulation of calcium ion transport
GO:0055085 P transmembrane transport
GO:0070059 P intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress
GO:0070588 P calcium ion transmembrane transport
GO:0071320 P cellular response to cAMP
GO:0071456 P cellular response to hypoxia
GO:0097060 C synaptic membrane
GO:1901215 P negative regulation of neuron death
GO:1903779 P regulation of cardiac conduction
RNA-seq EntryA_ErmoMG_comp21468_c0_seq1
Sequence
(Amino Acid)
ETLMFLDCICGSTTGGLGLLGLYINEGNVALINQTLETLTEYCQGPCHENQNCIATHESN
GLDIITALILNDINPLGKTRMDLVLELKNNASKLLLAIMESRNDSENNAERILYNMKKK
(38 a.a.)

- SilkBase 1999-2023 -