SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_ErmoMG1764_internal:A_ErmoMG_comp21075_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_N(G),N(G)-dimethylarginine_dimethylaminohydrolase_1_[Bombyx_mori]
Ontology
GO:0000052 P citrulline metabolic process
GO:0003073 P regulation of systemic arterial blood pressure
GO:0003824 F catalytic activity
GO:0005739 C mitochondrion
GO:0005829 C cytosol
GO:0006525 P arginine metabolic process
GO:0006527 P arginine catabolic process
GO:0007263 P nitric oxide mediated signal transduction
GO:0016403 F dimethylargininase activity
GO:0016597 F amino acid binding
GO:0016787 F hydrolase activity
GO:0045429 P positive regulation of nitric oxide biosynthetic process
GO:0045766 P positive regulation of angiogenesis
GO:0046872 F metal ion binding
GO:0050999 P regulation of nitric-oxide synthase activity
GO:0070062 C extracellular exosome
RNA-seq EntryA_ErmoMG_comp21075_c0_seq1
Sequence
(Amino Acid)
DILFTGREFFVGICNTTNEAGASLVAEAFPEFPCTPIKVSRGAQHLKKYITVAGDDVLCV
GASQEAKELLKRMEREATFSYQTLSVPEDEAANCLYVNGTLVHRAIEEIPEA
(36 a.a.)

- SilkBase 1999-2023 -