SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_ErmoMG17492_complete:A_ErmoMG_comp37478_c3_seq12
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000794 C condensed nuclear chromosome
GO:0005515 F protein binding
GO:0005783 C endoplasmic reticulum
GO:0005794 C Golgi apparatus
GO:0005813 C centrosome
GO:0005829 C cytosol
GO:0005871 C kinesin complex
GO:0005876 C spindle microtubule
GO:0005930 C axoneme
GO:0007017 P microtubule-based process
GO:0007018 P microtubule-based movement
GO:0008104 P protein localization
GO:0008285 P negative regulation of cell population proliferation
GO:0015630 C microtubule cytoskeleton
GO:0016939 C kinesin II complex
GO:0019894 F kinesin binding
GO:0030990 C intraciliary transport particle
GO:0032391 C photoreceptor connecting cilium
GO:0036064 C ciliary basal body
GO:0043066 P negative regulation of apoptotic process
GO:0046587 P positive regulation of calcium-dependent cell-cell adhesion
GO:0061024 P membrane organization
GO:0070062 C extracellular exosome
GO:1990075 C periciliary membrane compartment
RNA-seq EntryA_ErmoMG_comp37478_c3_seq12
Sequence
(Amino Acid)
MGTLSNILNPENIDIYAVVERYDLIPCIMKILNPEVAEGLGARSEEVLLEGVVMAGAVAA
EARAASALVRAGAGAALVAALPTHQADDEHVLQTVFAFRQLLSHPKAAQHLVTQTRTLTT
FNYKALTHKV
*(42 a.a.)

- SilkBase 1999-2023 -