SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_ErmoMG17228_complete:A_ErmoMG_comp37427_c0_seq3
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0004860 F protein kinase inhibitor activity
GO:0004861 F cyclin-dependent protein serine/threonine kinase inhibitor activity
GO:0005634 C nucleus
GO:0006469 P negative regulation of protein kinase activity
GO:0007049 P cell cycle
GO:0007050 P regulation of cell cycle
GO:0008406 P gonad development
GO:0032875 P regulation of DNA endoreduplication
GO:0045595 P regulation of cell differentiation
GO:0045596 P negative regulation of cell differentiation
GO:0045605 P negative regulation of epidermal cell differentiation
GO:0051302 P regulation of cell division
GO:0051782 P negative regulation of cell division
GO:0071850 P regulation of cell cycle
GO:0071901 P negative regulation of protein serine/threonine kinase activity
GO:1902806 P regulation of cell cycle G1/S phase transition
GO:2000134 P negative regulation of G1/S transition of mitotic cell cycle
RNA-seq EntryA_ErmoMG_comp37427_c0_seq3
Sequence
(Amino Acid)
MSALSVRAPGLQATTTMLDSRSLRVRGVTALDGVRRNLFGCTDREENRRYVERELARQLE
LDSQRWGFDFASEQPLPGIQRFAWQLVPASAVPAALRRSPITISTPKQNSSTPEPKVASP
ENTKTQKRITDFLKPRKRLSGSGKKSPAHNHKHECGHGAHIRPPKVARISQTHFKRTS
*(58 a.a.)

- SilkBase 1999-2023 -