SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_ErmoMG16274_internal:A_ErmoMG_comp37231_c0_seq7
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000166 F nucleotide binding
GO:0001676 P long-chain fatty acid metabolic process
GO:0003824 F catalytic activity
GO:0004467 F long-chain fatty acid-CoA ligase activity
GO:0005524 F ATP binding
GO:0005739 C mitochondrion
GO:0005741 C mitochondrial outer membrane
GO:0005777 C peroxisome
GO:0005778 C peroxisomal membrane
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0005794 C Golgi apparatus
GO:0005811 C lipid droplet
GO:0006629 P lipid metabolic process
GO:0006631 P fatty acid metabolic process
GO:0006633 P fatty acid biosynthetic process
GO:0007420 P brain development
GO:0007584 P response to nutrient
GO:0008152 P metabolic process
GO:0014070 P response to organic cyclic compound
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016874 F ligase activity
GO:0019901 F protein kinase binding
GO:0019904 F protein domain specific binding
GO:0031090 C organelle membrane
GO:0034379 P very-low-density lipoprotein particle assembly
GO:0042998 P positive regulation of Golgi to plasma membrane protein transport
GO:0043231 C intracellular membrane-bounded organelle
GO:0044539 P long-chain fatty acid import into cell
GO:0048471 C perinuclear region of cytoplasm
GO:0051047 P positive regulation of secretion
GO:2001247 P positive regulation of phosphatidylcholine biosynthetic process
RNA-seq EntryA_ErmoMG_comp37231_c0_seq7
Sequence
(Amino Acid)
EAIAHGINETEVSTVITTHDLLPKFKKILAKTPRVHTLVYMEDQLKPTDTQGFKEGIKIV
GYKDVVKQGRESNIEAVSPTASDTAIIMYTSGSTGVPKGVVLSHRNMLATLKAFADAIPI
HRGDLLMGFLPLAHVFELLAENLCIIGGVPIGYST
(50 a.a.)

- SilkBase 1999-2023 -