SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_ErmoMG15242_3prime_partial:A_ErmoMG_comp37000_c2_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005874 C microtubule
GO:0006897 P endocytosis
GO:0007275 P multicellular organism development
GO:0008021 C synaptic vesicle
GO:0030018 C Z disc
GO:0030100 P regulation of endocytosis
GO:0030154 P cell differentiation
GO:0030315 C T-tubule
GO:0030424 C axon
GO:0031674 C I band
GO:0032403 F protein-containing complex binding
GO:0033268 C node of Ranvier
GO:0043065 P positive regulation of apoptotic process
GO:0043194 C axon initial segment
GO:0043196 C varicosity
GO:0043547 P positive regulation of GTPase activity
GO:0043679 C axon terminus
GO:0044300 C cerebellar mossy fiber
GO:0045664 P regulation of neuron differentiation
GO:0045807 P positive regulation of endocytosis
GO:0046982 F protein heterodimerization activity
GO:0048711 P positive regulation of astrocyte differentiation
GO:0051020 F GTPase binding
GO:0060987 C lipid tube
GO:0060988 P lipid tube assembly
GO:0071156 P regulation of cell cycle
RNA-seq EntryA_ErmoMG_comp37000_c2_seq1
Sequence
(Amino Acid)
MAESKGALIAKTVQKHAGRAKEKFLQNLGKVDRTLDDIFEEHLQNFNRQHQQSTRLQKEF
NNYIRCIRAAQTASKSLMEAITEVYESGWSGHDLLYVQAQNMEMLWQDFSHKLGDQVLIP
LNTYTNQFPEVRKKIEKRGRKLVDYDSQR
(48 a.a.)

- SilkBase 1999-2023 -