SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_ErmoMG15074_complete:A_ErmoMG_comp36959_c0_seq5
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000166 F nucleotide binding
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0006468 P protein phosphorylation
GO:0006897 P endocytosis
GO:0007623 P circadian rhythm
GO:0008360 P regulation of cell shape
GO:0016055 P Wnt signaling pathway
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0018105 P peptidyl-serine phosphorylation
GO:0030177 P positive regulation of Wnt signaling pathway
GO:0030178 P negative regulation of Wnt signaling pathway
GO:0030529 C ribonucleoprotein complex
GO:0032091 P negative regulation of protein binding
GO:0032436 P positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0032922 P circadian regulation of gene expression
GO:0034613 P cellular protein localization
GO:0042752 P regulation of circadian rhythm
GO:0044822 F RNA binding
GO:0048511 P rhythmic process
GO:0090263 P positive regulation of canonical Wnt signaling pathway
GO:1903827 P regulation of protein localization
GO:2000052 P positive regulation of non-canonical Wnt signaling pathway
RNA-seq EntryA_ErmoMG_comp36959_c0_seq5
Sequence
(Amino Acid)
MYFNRGSLPWQGLKAATKRQKYERISEKKLSTPFDELCKNHPIEFQLYLKYCRRLRFEER
PDYTHLRQLFRTLFHRQGFTYDYVFDWNMLKFGGQRDNHQTSGIDRALRRLEQNQEQENT
AATAGQPSNAVAAISEWR
*(45 a.a.)

- SilkBase 1999-2023 -