SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_ErmoMG14959_5prime_partial:A_ErmoMG_comp36932_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000785 C chromatin
GO:0001933 P negative regulation of protein phosphorylation
GO:0001963 P synaptic transmission, dopaminergic
GO:0003713 F transcription coactivator activity
GO:0003723 F RNA binding
GO:0003729 F mRNA binding
GO:0005102 F signaling receptor binding
GO:0005507 F copper ion binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005783 C endoplasmic reticulum
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0006469 P negative regulation of protein kinase activity
GO:0006508 P proteolysis
GO:0006517 P protein deglycosylation
GO:0006914 P autophagy
GO:0006954 P inflammatory response
GO:0007005 P mitochondrion organization
GO:0007338 P single fertilization
GO:0008134 F transcription factor binding
GO:0008233 F peptidase activity
GO:0008344 P adult locomotory behavior
GO:0010273 P detoxification of copper ion
GO:0010628 P positive regulation of gene expression
GO:0010629 P negative regulation of gene expression
GO:0016020 C membrane
GO:0016532 F superoxide dismutase copper chaperone activity
GO:0016684 F oxidoreductase activity, acting on peroxide as acceptor
GO:0016787 F hydrolase activity
GO:0018323 P obsolete enzyme active site formation via L-cysteine sulfinic acid
GO:0019172 F glyoxalase III activity
GO:0019243 P methylglyoxal catabolic process to D-lactate via S-lactoyl-glutathione
GO:0019249 P lactate biosynthetic process
GO:0019899 F enzyme binding
GO:0019900 F kinase binding
GO:0019955 F cytokine binding
GO:0031397 P negative regulation of protein ubiquitination
GO:0032091 P negative regulation of protein binding
GO:0032435 P negative regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0032757 P positive regulation of interleukin-8 production
GO:0033138 P positive regulation of peptidyl-serine phosphorylation
GO:0033234 P negative regulation of protein sumoylation
GO:0034599 P cellular response to oxidative stress
GO:0034614 P cellular response to reactive oxygen species
GO:0036470 F tyrosine 3-monooxygenase activator activity
GO:0036471 P cellular response to glyoxal
GO:0036478 F L-dopa decarboxylase activator activity
GO:0042177 P negative regulation of protein catabolic process
GO:0042542 P response to hydrogen peroxide
GO:0042743 P hydrogen peroxide metabolic process
GO:0042802 F identical protein binding
GO:0042803 F protein homodimerization activity
GO:0043005 C neuron projection
GO:0043066 P negative regulation of apoptotic process
GO:0043523 P regulation of neuron apoptotic process
GO:0043524 P negative regulation of neuron apoptotic process
GO:0044297 C cell body
GO:0044388 F small protein activating enzyme binding
GO:0044390 F ubiquitin-like protein conjugating enzyme binding
GO:0045121 C membrane raft
GO:0045340 F mercury ion binding
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046295 P glycolate biosynthetic process
GO:0046826 P negative regulation of protein export from nucleus
GO:0050681 F androgen receptor binding
GO:0050727 P regulation of inflammatory response
GO:0050787 P detoxification of mercury ion
GO:0050821 P protein stabilization
GO:0051091 P positive regulation of DNA-binding transcription factor activity
GO:0051444 P negative regulation of ubiquitin-protein transferase activity
GO:0051583 P dopamine uptake involved in synaptic transmission
GO:0051881 P regulation of mitochondrial membrane potential
GO:0051899 P membrane depolarization
GO:0051920 F peroxiredoxin activity
GO:0060081 P membrane hyperpolarization
GO:0060548 P negative regulation of cell death
GO:0060765 P regulation of androgen receptor signaling pathway
GO:0070062 C extracellular exosome
GO:0070301 P cellular response to hydrogen peroxide
GO:0070491 F DNA-binding transcription factor binding
GO:0090073 P positive regulation of protein homodimerization activity
GO:0097110 F scaffold protein binding
GO:0098793 C presynapse
GO:0098869 P cellular oxidant detoxification
GO:1900182 P positive regulation of protein localization to nucleus
GO:1901215 P negative regulation of neuron death
GO:1901671 P positive regulation of superoxide dismutase activity
GO:1901984 P negative regulation of protein acetylation
GO:1902177 P positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway
GO:1902236 P negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway
GO:1902958 P positive regulation of mitochondrial electron transport, NADH to ubiquinone
GO:1903094 P negative regulation of protein K48-linked deubiquitination
GO:1903122 P negative regulation of TRAIL-activated apoptotic signaling pathway
GO:1903135 F cupric ion binding
GO:1903136 F cuprous ion binding
GO:1903168 P positive regulation of pyrroline-5-carboxylate reductase activity
GO:1903178 P positive regulation of tyrosine 3-monooxygenase activity
GO:1903181 P positive regulation of dopamine biosynthetic process
GO:1903190 P glyoxal catabolic process
GO:1903197 P positive regulation of L-dopa biosynthetic process
GO:1903200 P positive regulation of L-dopa decarboxylase activity
GO:1903202 P negative regulation of oxidative stress-induced cell death
GO:1903204 P negative regulation of oxidative stress-induced neuron death
GO:1903206 P negative regulation of hydrogen peroxide-induced cell death
GO:1903208 P negative regulation of hydrogen peroxide-induced neuron death
GO:1903377 P negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway
GO:1903384 P negative regulation of hydrogen peroxide-induced neuron intrinsic apoptotic signaling pathway
GO:1903428 P positive regulation of reactive oxygen species biosynthetic process
GO:1990381 F ubiquitin-specific protease binding
GO:1990422 F glyoxalase (glycolic acid-forming) activity
GO:2000157 P negative regulation of ubiquitin-specific protease activity
GO:2000277 P positive regulation of oxidative phosphorylation uncoupler activity
GO:2000679 P positive regulation of transcription regulatory region DNA binding
GO:2000825 P positive regulation of androgen receptor activity
GO:2001237 P negative regulation of extrinsic apoptotic signaling pathway
GO:2001268 P negative regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway
RNA-seq EntryA_ErmoMG_comp36932_c0_seq1
Sequence
(Amino Acid)
SRMRWARAASCLFSKTFTKYSSHLFFTNIHSQSRTMSKSALVILAQGAEEMETVITVDML
RRAGITVTLAGLDGPGPVLCSRQITIVPDRSLTDALAEKKLYDAVILPGGLEGAERLSKS
ETVGKLLKESEEAGSVILAAICAAPTVFAAHGVAKGRRVTSYPSTKDKLPNETYTYVEGQ
RVVVDGVVVTSRGPGTAYWFGLTLIEMLTDKAKADQVEKGMLISQY
*(74 a.a.)

- SilkBase 1999-2023 -