SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_ErmoMG14468_3prime_partial:A_ErmoMG_comp36810_c1_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000166 F nucleotide binding
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004702 F obsolete signal transducer, downstream of receptor, with serine/threonine kinase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0006468 P protein phosphorylation
GO:0006915 P apoptotic process
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0023014 P signal transduction
GO:0030334 P regulation of cell migration
GO:0031252 C cell leading edge
GO:0033129 P positive regulation of histone phosphorylation
GO:0042803 F protein homodimerization activity
GO:0043065 P positive regulation of apoptotic process
GO:0046777 P protein autophosphorylation
GO:0051893 P regulation of focal adhesion assembly
GO:0071356 P cellular response to tumor necrosis factor
RNA-seq EntryA_ErmoMG_comp36810_c1_seq1
Sequence
(Amino Acid)
MSFLNNLKKVLHLGGGNDAKKKKVFNNIRDNSDPAEYWEMIGELGDGAFGKVYKAQHKTT
SQLAAAKMCVLDNEDDLADFTVEIDILSECRHPNVVELHEAYFIDNKLWMLLEYCDGGAL
DSVIAELEKGLSELQIAYVCR
(46 a.a.)

- SilkBase 1999-2023 -