SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_ErmoMG14423_3prime_partial:A_ErmoMG_comp36798_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000165 P MAPK cascade
GO:0000209 P protein polyubiquitination
GO:0000502 C proteasome complex
GO:0002223 P stimulatory C-type lectin receptor signaling pathway
GO:0002479 P antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0006511 P ubiquitin-dependent protein catabolic process
GO:0006521 P regulation of cellular amino acid metabolic process
GO:0008134 F transcription factor binding
GO:0008540 C proteasome regulatory particle, base subcomplex
GO:0022624 C proteasome accessory complex
GO:0031145 P anaphase-promoting complex-dependent catabolic process
GO:0031593 F polyubiquitin modification-dependent protein binding
GO:0033209 P tumor necrosis factor-mediated signaling pathway
GO:0038061 P NIK/NF-kappaB signaling
GO:0038095 P Fc-epsilon receptor signaling pathway
GO:0042802 F identical protein binding
GO:0043161 P proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0043248 P proteasome assembly
GO:0043488 P regulation of mRNA stability
GO:0044822 F RNA binding
GO:0050852 P T cell receptor signaling pathway
GO:0051436 P obsolete negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle
GO:0051437 P obsolete positive regulation of ubiquitin-protein ligase activity involved in regulation of mitotic cell cycle transition
GO:0060071 P Wnt signaling pathway, planar cell polarity pathway
GO:0090090 P negative regulation of canonical Wnt signaling pathway
GO:0090263 P positive regulation of canonical Wnt signaling pathway
RNA-seq EntryA_ErmoMG_comp36798_c0_seq1
Sequence
(Amino Acid)
MVLESTMICVDNSDYMRNGDFLPTRLQAQQDAVNLVCHSKTRSNPENNVGLLTLANVEVL
ATLTSDVGRIMSKLHRVQPNGDINLLTGIRIAHLALKHRQGKNHKMRIVVFVGSPVNTDE
KELVKL
(41 a.a.)

- SilkBase 1999-2023 -