SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_ErmoMG139_internal:A_ErmoMG_comp16642_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
potassium/chloride_symporter_[Anopheles_darlingi]
Ontology
GO:0001525 P angiogenesis
GO:0005215 F transporter activity
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006813 P potassium ion transport
GO:0007268 P chemical synaptic transmission
GO:0010107 P potassium ion import across plasma membrane
GO:0015079 F potassium ion transmembrane transporter activity
GO:0015293 F symporter activity
GO:0015377 F cation:chloride symporter activity
GO:0015379 F potassium:chloride symporter activity
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016323 C basolateral plasma membrane
GO:0019901 F protein kinase binding
GO:0022820 F potassium:chloride symporter activity
GO:0035826 P obsolete rubidium ion transport
GO:0035827 F obsolete rubidium ion transmembrane transporter activity
GO:0055085 P transmembrane transport
GO:0071476 P cellular hypotonic response
GO:0071477 P cellular hypotonic salinity response
GO:0071805 P potassium ion transmembrane transport
GO:1902476 P chloride transmembrane transport
RNA-seq EntryA_ErmoMG_comp16642_c0_seq1
Sequence
(Amino Acid)
LLFAGTVDNLLLRDKFGQSIGGKLVVANMAWPNQWVILIGSFLSTLGAGLQSLTGAPRLL
QAIAKDEIIPFLAPFAVSSKRGEPTRALLLTMAICQCGILLGNVDILAPLLSMFFLMCYG
FVNLACALQTLLKTP
(44 a.a.)

- SilkBase 1999-2023 -