SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_ErmoMG13848_5prime_partial:A_ErmoMG_comp36648_c0_seq2
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000989 F obsolete transcription factor activity, transcription factor binding
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005741 C mitochondrial outer membrane
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0006913 P nucleocytoplasmic transport
GO:0016020 C membrane
GO:0046983 F protein dimerization activity
GO:1900402 P obsolete regulation of carbohydrate metabolic process by regulation of transcription from RNA polymerase II promoter
RNA-seq EntryA_ErmoMG_comp36648_c0_seq2
Sequence
(Amino Acid)
KFLDLCVRVCVRPRVQFSVVSATLVESFSACVSCGSGADLVRTTLLWAEQHCSLVELRPA
VLNSLRILCTTTDILTNPERLPEEARAAVAASAAVKTEPT
*(32 a.a.)

- SilkBase 1999-2023 -