SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_ErmoMG13832_internal:A_ErmoMG_comp36639_c0_seq2
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000123 C histone acetyltransferase complex
GO:0001205 F DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0003682 F chromatin binding
GO:0003700 F DNA-binding transcription factor activity
GO:0003713 F transcription coactivator activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005671 C obsolete Ada2/Gcn5/Ada3 transcription activator complex
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0006355 P regulation of transcription, DNA-templated
GO:0006366 P transcription by RNA polymerase II
GO:0007005 P mitochondrion organization
GO:0007049 P cell cycle
GO:0010628 P positive regulation of gene expression
GO:0016020 C membrane
GO:0016032 P viral process
GO:0016568 P chromatin organization
GO:0019046 P release from viral latency
GO:0030424 C axon
GO:0030425 C dendrite
GO:0042802 F identical protein binding
GO:0043025 C neuronal cell body
GO:0043254 P regulation of protein-containing complex assembly
GO:0043981 P histone H4-K5 acetylation
GO:0043982 P histone H4-K8 acetylation
GO:0043984 P histone H4-K16 acetylation
GO:0043995 F histone acetyltransferase activity (H4-K5 specific)
GO:0043996 F histone acetyltransferase activity (H4-K8 specific)
GO:0045787 P positive regulation of cell cycle
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046972 F histone acetyltransferase activity (H4-K16 specific)
GO:0048188 C Set1C/COMPASS complex
GO:0050821 P protein stabilization
GO:0070461 C SAGA-type complex
GO:0070688 C obsolete MLL5-L complex
GO:0071339 C MLL1 complex
GO:0071407 P cellular response to organic cyclic compound
RNA-seq EntryA_ErmoMG_comp36639_c0_seq2
Sequence
(Amino Acid)
YGVLSIAFSNKCIVKMKENAILKWQKVYNPTGPQPRPRHGHRAVAIKDLMIVFGGGNEGI
VHELHVFNTTTNQWFVPVTKGEVPPGCAAYGFVVDGTRLLVFGGMVEYGKYSNDLYELQA
SRWEWKRLKPLPPKQGIPPCARLGHSFTLLNGKVYLFGGLANESDDPKNNIPRYLNDLYI
LGLYPNSSMTLWDIPLTYGQSPPPRESHSGVAYTDKSTGKSSLIIYGGMSGSRLGDLWVL
DVDSMSWSRPEVGGPPPLPRSLHTATVIGHHMYVYGGWVPLVPDESKLATHEKEWKCTNT
LASLNLETMTWDNIALDKFEECVPRARAGHSAVAIQTR
(111 a.a.)

- SilkBase 1999-2023 -