SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_ErmoMG13825_5prime_partial:A_ErmoMG_comp36638_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0003676 F nucleic acid binding
GO:0003723 F RNA binding
GO:0005515 F protein binding
GO:0005739 C mitochondrion
GO:0005741 C mitochondrial outer membrane
GO:0005743 C mitochondrial inner membrane
GO:0005759 C mitochondrial matrix
GO:0005811 C lipid droplet
GO:0005829 C cytosol
GO:0007596 P blood coagulation
GO:0008017 F microtubule binding
GO:0010614 P negative regulation of cardiac muscle hypertrophy
GO:0010738 P regulation of protein kinase A signaling
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0019901 F protein kinase binding
GO:0019903 F protein phosphatase binding
GO:0019904 F protein domain specific binding
GO:0030061 C mitochondrial crista
GO:0030346 F protein phosphatase 2B binding
GO:0031594 C neuromuscular junction
GO:0032947 F molecular adaptor activity
GO:0034237 F protein kinase A regulatory subunit binding
GO:0035308 P negative regulation of protein dephosphorylation
GO:0044822 F RNA binding
GO:0045211 C postsynaptic membrane
GO:0048487 F beta-tubulin binding
GO:0051534 P negative regulation of calcineurin-NFAT signaling cascade
GO:0071320 P cellular response to cAMP
GO:0071375 P cellular response to peptide hormone stimulus
RNA-seq EntryA_ErmoMG_comp36638_c0_seq1
Sequence
(Amino Acid)
LVDFGGYLTVDNDQLKQIRSDFMTLPFQATEALLAFVKPANNAEWSGEALRIMAGLTAGQ
LLHAQVAGYDETGLPLVHLYLTLHPQQVIFLNRELVERGLAEWDIPPDS
*(35 a.a.)

- SilkBase 1999-2023 -