SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_ErmoMG1372_internal:A_ErmoMG_comp19480_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_histone_acetyltransferase_KAT2B-like,_partial_[Amyelois_transitella]
Ontology
GO:0000123 C histone acetyltransferase complex
GO:0000790 C chromatin
GO:0001701 P in utero embryonic development
GO:0001756 P somitogenesis
GO:0001843 P neural tube closure
GO:0003682 F chromatin binding
GO:0003713 F transcription coactivator activity
GO:0004402 F histone acetyltransferase activity
GO:0005515 F protein binding
GO:0005615 C extracellular space
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005671 C obsolete Ada2/Gcn5/Ada3 transcription activator complex
GO:0006338 P chromatin remodeling
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0006366 P transcription by RNA polymerase II
GO:0007399 P nervous system development
GO:0008080 F N-acetyltransferase activity
GO:0008134 F transcription factor binding
GO:0008283 P cell population proliferation
GO:0010484 F H3 histone acetyltransferase activity
GO:0014070 P response to organic cyclic compound
GO:0016032 P viral process
GO:0016407 F acetyltransferase activity
GO:0016573 P histone acetylation
GO:0016578 P histone deubiquitination
GO:0016740 F transferase activity
GO:0016746 F acyltransferase activity
GO:0019903 F protein phosphatase binding
GO:0021537 P telencephalon development
GO:0022037 P metencephalon development
GO:0030901 P midbrain development
GO:0030914 C SAGA complex
GO:0031346 P positive regulation of cell projection organization
GO:0031647 P regulation of protein stability
GO:0031667 P response to nutrient levels
GO:0033276 C transcription factor TFTC complex
GO:0035066 P positive regulation of histone acetylation
GO:0035264 P multicellular organism growth
GO:0035948 P obsolete positive regulation of gluconeogenesis by positive regulation of transcription from RNA polymerase II promoter
GO:0042826 F histone deacetylase binding
GO:0043966 P histone H3 acetylation
GO:0043983 P histone H4-K12 acetylation
GO:0043997 F histone acetyltransferase activity (H4-K12 specific)
GO:0044154 P histone H3-K14 acetylation
GO:0045815 P epigenetic maintenance of chromatin in transcription-competent conformation
GO:0048312 P intracellular distribution of mitochondria
GO:0055007 P cardiac muscle cell differentiation
GO:0071356 P cellular response to tumor necrosis factor
GO:0071929 P alpha-tubulin acetylation
GO:0072686 C mitotic spindle
GO:1903146 P regulation of autophagy of mitochondrion
GO:1903955 P positive regulation of protein targeting to mitochondrion
GO:1990090 P cellular response to nerve growth factor stimulus
GO:2000679 P positive regulation of transcription regulatory region DNA binding
RNA-seq EntryA_ErmoMG_comp19480_c0_seq1
Sequence
(Amino Acid)
GNTLTGAVNKQTMLWLIGLHNVFSHQLPEMTKEYISQLVFDPKHKTLALIKEGRPIGGIC
FRTFHSQGFSEIVFCAVTSNEQVKGYGTHLMNHLKDYHIRNNILHFLTFADEFAIGYFKK
QGFSKDIKLPRAMYQGYIKDYEGATLMHCELNPRIVYTHFTAVIRTQKEIVKKLIDMRQK
EVRKVYPGLSCFKEGV
(64 a.a.)

- SilkBase 1999-2023 -