SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_ErmoMG1358_5prime_partial:A_ErmoMG_comp19453_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_histone_acetyltransferase_KAT2B-like,_partial_[Amyelois_transitella]
Ontology
GO:0000123 C histone acetyltransferase complex
GO:0000776 C kinetochore
GO:0000790 C chromatin
GO:0000977 F RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0003682 F chromatin binding
GO:0003712 F transcription coregulator activity
GO:0003713 F transcription coactivator activity
GO:0004402 F histone acetyltransferase activity
GO:0004468 F lysine N-acetyltransferase activity, acting on acetyl phosphate as donor
GO:0004861 F cyclin-dependent protein serine/threonine kinase inhibitor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005671 C obsolete Ada2/Gcn5/Ada3 transcription activator complex
GO:0005829 C cytosol
GO:0006338 P chromatin remodeling
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006361 P transcription initiation from RNA polymerase I promoter
GO:0006473 P protein acetylation
GO:0007049 P cell cycle
GO:0007219 P Notch signaling pathway
GO:0007613 P memory
GO:0008080 F N-acetyltransferase activity
GO:0008134 F transcription factor binding
GO:0008285 P negative regulation of cell population proliferation
GO:0010835 P regulation of protein ADP-ribosylation
GO:0010976 P positive regulation of neuron projection development
GO:0016407 F acetyltransferase activity
GO:0016573 P histone acetylation
GO:0016740 F transferase activity
GO:0016746 F acyltransferase activity
GO:0018076 P N-terminal peptidyl-lysine acetylation
GO:0018393 P internal peptidyl-lysine acetylation
GO:0018394 P peptidyl-lysine acetylation
GO:0019901 F protein kinase binding
GO:0031672 C A band
GO:0031674 C I band
GO:0032403 F protein-containing complex binding
GO:0032869 P cellular response to insulin stimulus
GO:0034599 P cellular response to oxidative stress
GO:0035035 F histone acetyltransferase binding
GO:0035563 P positive regulation of chromatin binding
GO:0035948 P obsolete positive regulation of gluconeogenesis by positive regulation of transcription from RNA polymerase II promoter
GO:0042641 C actomyosin
GO:0042826 F histone deacetylase binding
GO:0043966 P histone H3 acetylation
GO:0043970 P histone H3-K9 acetylation
GO:0045736 P negative regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045909 P vasodilation
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0048511 P rhythmic process
GO:0071374 P cellular response to parathyroid hormone stimulus
GO:0071442 P positive regulation of histone H3-K14 acetylation
GO:2000617 P positive regulation of histone H3-K9 acetylation
RNA-seq EntryA_ErmoMG_comp19453_c0_seq1
Sequence
(Amino Acid)
RAPAAPHEPEPDALLLRNVLHAVKNHAAAWPFLKPVDKAEVPDYYDHIKYPMDLRTMGER
LKARYYVSKRLFIADMTRIFNNCRLYNSPDTDYYRCANTLEKYFQTKMKEVGLWDK
*(38 a.a.)

- SilkBase 1999-2023 -