SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_ErmoMG13289_internal:A_ErmoMG_comp36502_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0005154 F epidermal growth factor receptor binding
GO:0005158 F insulin receptor binding
GO:0005737 C cytoplasm
GO:0005768 C endosome
GO:0005829 C cytosol
GO:0006810 P transport
GO:0006886 P intracellular protein transport
GO:0006897 P endocytosis
GO:0008289 F lipid binding
GO:0010008 C endosome membrane
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016050 P vesicle organization
GO:0019898 C extrinsic component of membrane
GO:0030027 C lamellipodium
GO:0030904 C retromer complex
GO:0030905 C retromer, tubulation complex
GO:0031901 C early endosome membrane
GO:0034498 P early endosome to Golgi transport
GO:0035091 F phosphatidylinositol binding
GO:0042147 P retrograde transport, endosome to Golgi
GO:0042803 F protein homodimerization activity
GO:0042995 C cell projection
GO:0043234 C protein-containing complex
GO:0046982 F protein heterodimerization activity
GO:0051259 P protein complex oligomerization
GO:0070062 C extracellular exosome
GO:0072673 P lamellipodium morphogenesis
GO:1990459 F transferrin receptor binding
GO:1990460 F leptin receptor binding
RNA-seq EntryA_ErmoMG_comp36502_c0_seq1
Sequence
(Amino Acid)
KLNLCLFYTGTTKLKMTSTPSTETANGSISNAAVQSQFVERRRAALERFLNRVAQHPVLS
IDPDFREFLESDTELPKATSTSALSGAGMLRLFNKVGETVNKITYRMDEADPWFEERVVR
VETLEACLRRLAGACEALAGERREL
(47 a.a.)

- SilkBase 1999-2023 -