SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_ErmoMG13157_complete:A_ErmoMG_comp36458_c1_seq2
Scaffold_id
NCBI non-redundant
(nr)
4-aminobutyrate_aminotransferase_[Chilo_suppressalis]
Ontology
GO:0001666 P response to hypoxia
GO:0003824 F catalytic activity
GO:0003867 F 4-aminobutyrate transaminase activity
GO:0005739 C mitochondrion
GO:0005759 C mitochondrial matrix
GO:0007568 P aging
GO:0007620 P copulation
GO:0007626 P locomotory behavior
GO:0008483 F transaminase activity
GO:0009448 P gamma-aminobutyric acid metabolic process
GO:0009449 P gamma-aminobutyric acid biosynthetic process
GO:0009450 P gamma-aminobutyric acid catabolic process
GO:0010039 P response to iron ion
GO:0014053 P negative regulation of gamma-aminobutyric acid secretion
GO:0016740 F transferase activity
GO:0021549 P cerebellum development
GO:0030170 F pyridoxal phosphate binding
GO:0031652 P positive regulation of heat generation
GO:0032024 P positive regulation of insulin secretion
GO:0032144 C 4-aminobutyrate transaminase complex
GO:0032145 F succinate-semialdehyde dehydrogenase binding
GO:0033602 P negative regulation of dopamine secretion
GO:0035094 P response to nicotine
GO:0035640 P exploration behavior
GO:0042135 P neurotransmitter catabolic process
GO:0042220 P response to cocaine
GO:0042493 P response to xenobiotic stimulus
GO:0042802 F identical protein binding
GO:0042803 F protein homodimerization activity
GO:0043005 C neuron projection
GO:0045471 P response to ethanol
GO:0045776 P negative regulation of blood pressure
GO:0045964 P positive regulation of dopamine metabolic process
GO:0046872 F metal ion binding
GO:0047298 F (S)-3-amino-2-methylpropionate transaminase activity
GO:0048148 P behavioral response to cocaine
GO:0051536 F iron-sulfur cluster binding
GO:0070062 C extracellular exosome
GO:0070474 P positive regulation of uterine smooth muscle contraction
GO:0090331 P negative regulation of platelet aggregation
GO:0097151 P positive regulation of inhibitory postsynaptic potential
GO:1902722 P positive regulation of prolactin secretion
GO:1904450 P positive regulation of aspartate secretion
RNA-seq EntryA_ErmoMG_comp36458_c1_seq2
Sequence
(Amino Acid)
MWCHEHFNLPSPPDLVTFSKKMLTGGFYFTADFRTPHAYRVFNTWMGDPGKLILLERVLK
VIKQEQLLNLVNKTGQILKSGLHNFEKEFPGLIHSVRGRGTFLSFNAPSSETRDKINNSL
KKNGVLSGTCGDHAIRLRPALIFEPKHAEIYLDILRKALKEI
*(53 a.a.)

- SilkBase 1999-2023 -