SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_ErmoMG13046_5prime_partial:A_ErmoMG_comp36416_c0_seq2
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_transcription_elongation_factor_SPT5,_partial_[Papilio_polytes]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000176 C nuclear exosome (RNase complex)
GO:0005634 C nucleus
GO:0005694 C chromosome
GO:0005700 C polytene chromosome
GO:0005703 C polytene chromosome puff
GO:0005705 C polytene chromosome interband
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0006368 P transcription elongation from RNA polymerase II promoter
GO:0007052 P mitotic spindle organization
GO:0007095 P mitotic G2 DNA damage checkpoint signaling
GO:0007549 P dosage compensation
GO:0008023 C transcription elongation factor complex
GO:0032044 C DSIF complex
GO:0032784 P regulation of DNA-templated transcription, elongation
GO:0032785 P negative regulation of DNA-templated transcription, elongation
GO:0032786 P positive regulation of DNA-templated transcription, elongation
GO:0035101 C FACT complex
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046982 F protein heterodimerization activity
RNA-seq EntryA_ErmoMG_comp36416_c0_seq2
Sequence
(Amino Acid)
FLYKNFTMSAILSEGVKPSLTELERFEEQPEGIDIELAAPAKDDPAGLHSFSMGDNVEVC
TGDLANLQARITAIDGSMITVMPKHDGLKDPIVFHPSELRKYFKMGDHVKVVAGDTKETL
VLLYESNRTALS
*(43 a.a.)

- SilkBase 1999-2023 -