SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_ErmoMG12906_internal:A_ErmoMG_comp36372_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_chromodomain-helicase-DNA-binding_protein_7_isoform_X2_[Amyelois_transitella]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000166 F nucleotide binding
GO:0001701 P in utero embryonic development
GO:0002039 F p53 binding
GO:0003677 F DNA binding
GO:0003678 F DNA helicase activity
GO:0003682 F chromatin binding
GO:0004386 F helicase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007420 P brain development
GO:0008013 F beta-catenin binding
GO:0008094 F ATP-dependent activity, acting on DNA
GO:0016055 P Wnt signaling pathway
GO:0016568 P chromatin organization
GO:0016787 F hydrolase activity
GO:0016817 F hydrolase activity, acting on acid anhydrides
GO:0030178 P negative regulation of Wnt signaling pathway
GO:0032508 P DNA duplex unwinding
GO:0035064 F methylated histone binding
GO:0042393 F histone binding
GO:0043044 P chromatin remodeling
GO:0043066 P negative regulation of apoptotic process
GO:0043234 C protein-containing complex
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0045945 P positive regulation of transcription by RNA polymerase III
GO:0048565 P digestive tract development
GO:0060070 P canonical Wnt signaling pathway
GO:0070016 F armadillo repeat domain binding
GO:0071339 C MLL1 complex
GO:0090090 P negative regulation of canonical Wnt signaling pathway
GO:2000270 P negative regulation of fibroblast apoptotic process
RNA-seq EntryA_ErmoMG_comp36372_c0_seq1
Sequence
(Amino Acid)
NHSGLHNPVPRGRNAKKKNRPKDIPKVTDVQKWEDSNHWSSNEKYDCEAYLESSYKKHLF
RHANKVLLRVRMMYYIKHEVIGDYATQIENGVHSSSLGMRVPRGVDSAPPRIWWDTECDI
SLLVGTYIHGYENYLAMRIDPQLCYIDKLGPPDDAECTDIKSEERKIRGAVGGDEDCTDE
VSSGAGATSPGASPRPDDDGGGGGTHLWPSMQDLNTRLRRLITAYQRNYKREELKLQQKA
KMERRERMDLIARDEASQWRWSRADEEAFRRTVASYGVEFDPSTKSLRWNRFRTLARLDS
KSDDALTDYLKAFMAMCKRQCGLSVGEAELPTRADLKAEPIGEERAIATLERIDLLRVLR
EEVAPHPALESRLSLCEPSADAPPWWQPATHDNLLIRAVCKHGLGDTYNKLFCDPKLPFA
ECARKWYQKSSKTETRKASSDEEDNVDKPVNDTRTLRRSKRTSHLVDRDHD
(156 a.a.)

- SilkBase 1999-2023 -