| Name | O_ErmoMG12806_3prime_partial:A_ErmoMG_comp36331_c0_seq4 |
| Scaffold_id | |
NCBI non-redundant (nr) | PREDICTED:_putative_pre-mRNA-splicing_factor_ATP-dependent_RNA_helicase_DHX15-like,_partial_[Apis_mellifera] |
| Ontology |
| GO:0000166 |
F |
nucleotide binding |
| GO:0000398 |
P |
mRNA splicing, via spliceosome |
| GO:0003676 |
F |
nucleic acid binding |
| GO:0003725 |
F |
double-stranded RNA binding |
| GO:0004004 |
F |
RNA helicase activity |
| GO:0004386 |
F |
helicase activity |
| GO:0005515 |
F |
protein binding |
| GO:0005524 |
F |
ATP binding |
| GO:0005634 |
C |
nucleus |
| GO:0005681 |
C |
spliceosomal complex |
| GO:0005689 |
C |
U12-type spliceosomal complex |
| GO:0005730 |
C |
nucleolus |
| GO:0005737 |
C |
cytoplasm |
| GO:0006397 |
P |
mRNA processing |
| GO:0008026 |
F |
helicase activity |
| GO:0008380 |
P |
RNA splicing |
| GO:0009636 |
P |
response to toxic substance |
| GO:0016787 |
F |
hydrolase activity |
| GO:0043279 |
P |
response to alkaloid |
| GO:0044822 |
F |
RNA binding |
| GO:0071008 |
C |
U2-type post-mRNA release spliceosomal complex |
|
| RNA-seq Entry | A_ErmoMG_comp36331_c0_seq4 |
Sequence (Amino Acid) | MDPPAPETLMRALELLNYLAALDDDGNLTDLGAVMAEFPLDPQLAKMLIASCNHNCSNEI
LSITAMLSVPQCFVRPNEARKAADEAKMRFAHIDGDHLTLLNVYHAFKQSQYTLH
(37 a.a.) |