SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_ErmoMG12760_3prime_partial:A_ErmoMG_comp36320_c0_seq4
Scaffold_id
NCBI non-redundant
(nr)
eukaryotic_initiation_factor_4A-III_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0000398 P mRNA splicing, via spliceosome
GO:0003676 F nucleic acid binding
GO:0003723 F RNA binding
GO:0003743 F translation initiation factor activity
GO:0004004 F RNA helicase activity
GO:0004386 F helicase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0006397 P mRNA processing
GO:0006413 P translational initiation
GO:0006810 P transport
GO:0006974 P cellular response to DNA damage stimulus
GO:0007275 P multicellular organism development
GO:0008380 P RNA splicing
GO:0010468 P regulation of gene expression
GO:0010501 P RNA secondary structure unwinding
GO:0016281 C eukaryotic translation initiation factor 4F complex
GO:0016787 F hydrolase activity
GO:0045451 P pole plasm oskar mRNA localization
GO:0045495 C pole plasm
GO:0046579 P positive regulation of Ras protein signal transduction
GO:0051028 P mRNA transport
GO:0070374 P positive regulation of ERK1 and ERK2 cascade
GO:0071011 C precatalytic spliceosome
GO:0071013 C catalytic step 2 spliceosome
GO:1903040 P exon-exon junction complex assembly
RNA-seq EntryA_ErmoMG_comp36320_c0_seq4
Sequence
(Amino Acid)
MASSEISTNRKILSEDLSNVEFDTSEDVEVIPTFDSMGLRDELLRGIYTYGFEKPSAIQQ
RSILPIVKGRDVIAQAQSGTGKTATFSISILQTLDTTIRETQVLILSPTREL
(36 a.a.)

- SilkBase 1999-2023 -