SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_ErmoMG12630_complete:A_ErmoMG_comp36278_c0_seq14
Scaffold_id
NCBI non-redundant
(nr)		Synaptic_vesicular_amine_transporter_[Papilio_xuthus]
Ontology
GO:0001975 P response to amphetamine
GO:0005275 F amine transmembrane transporter activity
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006810 P transport
GO:0006836 P neurotransmitter transport
GO:0006837 P serotonin transport
GO:0007268 P chemical synaptic transmission
GO:0007269 P neurotransmitter secretion
GO:0007568 P aging
GO:0007626 P locomotory behavior
GO:0008021 C synaptic vesicle
GO:0008144 F obsolete drug binding
GO:0008504 F monoamine transmembrane transporter activity
GO:0009635 P response to herbicide
GO:0009636 P response to toxic substance
GO:0009791 P post-embryonic development
GO:0010038 P response to metal ion
GO:0010043 P response to zinc ion
GO:0015222 F serotonin:sodium symporter activity
GO:0015842 P aminergic neurotransmitter loading into synaptic vesicle
GO:0015844 P monoamine transport
GO:0015872 P dopamine transport
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0019899 F enzyme binding
GO:0030073 P insulin secretion
GO:0030659 C cytoplasmic vesicle membrane
GO:0030672 C synaptic vesicle membrane
GO:0031045 C dense core granule
GO:0031072 F heat shock protein binding
GO:0031410 C cytoplasmic vesicle
GO:0032456 P endocytic recycling
GO:0035690 P cellular response to xenobiotic stimulus
GO:0042137 P sequestering of neurotransmitter
GO:0042220 P response to cocaine
GO:0042493 P response to xenobiotic stimulus
GO:0042593 P glucose homeostasis
GO:0042594 P response to starvation
GO:0042995 C cell projection
GO:0043005 C neuron projection
GO:0043025 C neuronal cell body
GO:0043195 C terminal bouton
GO:0043679 C axon terminus
GO:0044297 C cell body
GO:0051412 P response to corticosterone
GO:0051589 P negative regulation of neurotransmitter transport
GO:0055085 P transmembrane transport
GO:0070083 C clathrin-sculpted monoamine transport vesicle membrane
GO:0071242 P cellular response to ammonium ion
GO:0098700 P neurotransmitter loading into synaptic vesicle
GO:1903427 P negative regulation of reactive oxygen species biosynthetic process
RNA-seq EntryA_ErmoMG_comp36278_c0_seq14
Sequence
(Amino Acid)
MAALEPCLPLWISHKFHTERWQTGLVFIPDSAAYLVCSVCAGGTRRPGRTAALGQLTVGL
AALALPHAASVWGLVLPQSGVGAGLGCADAALFPALLARTHAHRPAAVLQAASSAAYTIG
PVLGGVLSWLVGFETTLRTLGVLNILYAWFLYQLLGDHPSSEWGGESEAESSDALAGEVT
PLSPAGEVYTSLH
*(63 a.a.)

- SilkBase 1999-2023 -