| Name | O_ErmoMG12568_3prime_partial:A_ErmoMG_comp36258_c0_seq5 |
| Scaffold_id | |
NCBI non-redundant
(nr) | PREDICTED:_cyclin-G-associated_kinase-like_isoform_X1_[Bombyx_mori] |
| Ontology |
| GO:0000166 |
F |
nucleotide binding |
| GO:0004672 |
F |
protein kinase activity |
| GO:0004674 |
F |
protein serine/threonine kinase activity |
| GO:0005515 |
F |
protein binding |
| GO:0005524 |
F |
ATP binding |
| GO:0005737 |
C |
cytoplasm |
| GO:0005794 |
C |
Golgi apparatus |
| GO:0005925 |
C |
focal adhesion |
| GO:0006468 |
P |
protein phosphorylation |
| GO:0007030 |
P |
Golgi organization |
| GO:0007049 |
P |
cell cycle |
| GO:0010977 |
P |
negative regulation of neuron projection development |
| GO:0016020 |
C |
membrane |
| GO:0016301 |
F |
kinase activity |
| GO:0016310 |
P |
phosphorylation |
| GO:0016740 |
F |
transferase activity |
| GO:0030054 |
C |
cell junction |
| GO:0031982 |
C |
vesicle |
| GO:0043231 |
C |
intracellular membrane-bounded organelle |
| GO:0048471 |
C |
perinuclear region of cytoplasm |
|
| RNA-seq Entry | A_ErmoMG_comp36258_c0_seq5 |
Sequence
(Amino Acid) | MSVFKSAMGYFSSSGANGGSDNEFVGQFVEIGNMKLRVKKVIAEGGFAFVFIAQDVASGT
EYALKRLMAADEQANKNIIQEISILKKLSGHPNVIKYIAASFIDKSKTSHGMGEYLLLTD
LCSGGSLMEALQNRGQAFPLPTILREYLLLTDLCSGGSLMEALQNRGQAFPLPTIL
(57 a.a.) |
