SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_ErmoMG1254_5prime_partial:A_ErmoMG_comp19248_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_LOW_QUALITY_PROTEIN:_adenylate_cyclase_type_9_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0003091 P renal water homeostasis
GO:0004016 F adenylate cyclase activity
GO:0005524 F ATP binding
GO:0005622 C intracellular anatomical structure
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006171 P cAMP biosynthetic process
GO:0007165 P signal transduction
GO:0007189 P adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0007190 P activation of adenylate cyclase activity
GO:0007193 P adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway
GO:0009190 P cyclic nucleotide biosynthetic process
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016829 F lyase activity
GO:0016849 F phosphorus-oxygen lyase activity
GO:0019933 P cAMP-mediated signaling
GO:0030424 C axon
GO:0030425 C dendrite
GO:0034199 P activation of protein kinase A activity
GO:0035556 P intracellular signal transduction
GO:0046872 F metal ion binding
GO:0071377 P cellular response to glucagon stimulus
GO:0071880 P adenylate cyclase-activating adrenergic receptor signaling pathway
RNA-seq EntryA_ErmoMG_comp19248_c0_seq1
Sequence
(Amino Acid)
LRQASRGTYDHLYQLMDFALEMQKVVDNFNHDLFEFDFILRIGYNFGDVTAGVIGTTKLY
YDIWGDAVNIASRMDSTGVPQRVQVGEACVPVLSAKYEFEPRGSVYVKGKDDMNVYLLIG
KKDT
*(40 a.a.)

- SilkBase 1999-2023 -