SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_ErmoMG12443_5prime_partial:A_ErmoMG_comp36229_c2_seq1
Scaffold_id
NCBI non-redundant
(nr)		synoviolin-like_protein_[Bombyx_mori]
Ontology
GO:0000151 C ubiquitin ligase complex
GO:0000209 P protein polyubiquitination
GO:0000836 C Hrd1p ubiquitin ligase complex
GO:0001701 P in utero embryonic development
GO:0005515 F protein binding
GO:0005654 C nucleoplasm
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0005790 C smooth endoplasmic reticulum
GO:0006986 P response to unfolded protein
GO:0007275 P multicellular organism development
GO:0008270 F zinc ion binding
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016567 P protein ubiquitination
GO:0016874 F ligase activity
GO:0018279 P protein N-linked glycosylation via asparagine
GO:0030163 P protein catabolic process
GO:0030433 P ubiquitin-dependent ERAD pathway
GO:0030968 P endoplasmic reticulum unfolded protein response
GO:0030970 P retrograde protein transport, ER to cytosol
GO:0036503 P ERAD pathway
GO:0036513 C Derlin-1 retrotranslocation complex
GO:0042787 P ubiquitin-dependent protein catabolic process
GO:0044322 C endoplasmic reticulum quality control compartment
GO:0046872 F metal ion binding
GO:0050821 P protein stabilization
GO:0051082 F unfolded protein binding
GO:0051087 F chaperone binding
GO:0051117 F ATPase binding
GO:0061630 F ubiquitin protein ligase activity
GO:0070936 P protein K48-linked ubiquitination
GO:1902236 P negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway
GO:1904264 F ubiquitin protein ligase activity
GO:1990381 F ubiquitin-specific protease binding
RNA-seq EntryA_ErmoMG_comp36229_c2_seq1
Sequence
(Amino Acid)
RLQLLREIQAMLDASVLLMQQYSTVASATQNNATIATQTEAQPDPAPEVKIKTEVEAVPS
TSQIKSPSPVPSTSKQEIKSDDLPDNTTDSERVKTDDDAAELRRRRLQKFTLDK
*(37 a.a.)

- SilkBase 1999-2023 -