SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_ErmoMG1240_3prime_partial:A_ErmoMG_comp19228_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)		Centrosomal_and_chromosomal_factor_[Operophtera_brumata]
Ontology
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005694 C chromosome
GO:0005700 C polytene chromosome
GO:0005737 C cytoplasm
GO:0005813 C centrosome
GO:0005815 C microtubule organizing center
GO:0005856 C cytoskeleton
GO:0006342 P heterochromatin assembly
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007049 P cell cycle
GO:0007067 P mitotic cell cycle
GO:0007076 P mitotic chromosome condensation
GO:0007474 P imaginal disc-derived wing vein specification
GO:0010468 P regulation of gene expression
GO:0035098 C ESC/E(Z) complex
GO:0035102 C PRC1 complex
GO:0042802 F identical protein binding
GO:0042803 F protein homodimerization activity
GO:0045433 P male courtship behavior, veined wing generated song production
GO:0051301 P cell division
GO:0060429 P epithelium development
RNA-seq EntryA_ErmoMG_comp19228_c0_seq1
Sequence
(Amino Acid)
MTGYARGEAEFAAADRFRRDARPASLAPRDYSVPLHVDCSIEYELPDCAKPPQGVKIEPL
LMIHPSHFRRLESLRRVPFVNNLPRGDAAAAAAVTPASRARAP
(33 a.a.)

- SilkBase 1999-2023 -