SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_ErmoMG12390_complete:A_ErmoMG_comp36209_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_disks_large_1_tumor_suppressor_protein_isoform_X12_[Papilio_xuthus]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000132 P establishment of mitotic spindle orientation
GO:0001708 P cell fate specification
GO:0001738 P morphogenesis of a polarized epithelium
GO:0002009 P morphogenesis of an epithelium
GO:0004385 F guanylate kinase activity
GO:0004871 F obsolete signal transducer activity
GO:0005154 F epidermal growth factor receptor binding
GO:0005198 F structural molecule activity
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005856 C cytoskeleton
GO:0005886 C plasma membrane
GO:0005918 C septate junction
GO:0005920 C smooth septate junction
GO:0005938 C cell cortex
GO:0007010 P cytoskeleton organization
GO:0007155 P cell adhesion
GO:0007165 P signal transduction
GO:0007268 P chemical synaptic transmission
GO:0007275 P multicellular organism development
GO:0007318 P pole plasm protein localization
GO:0007391 P dorsal closure
GO:0007399 P nervous system development
GO:0007617 P mating behavior
GO:0008049 P male courtship behavior
GO:0008104 P protein localization
GO:0008105 P protein localization
GO:0008283 P cell population proliferation
GO:0008285 P negative regulation of cell population proliferation
GO:0008328 C ionotropic glutamate receptor complex
GO:0008593 P regulation of Notch signaling pathway
GO:0010906 P regulation of glucose metabolic process
GO:0014069 C postsynaptic density
GO:0016020 C membrane
GO:0016323 C basolateral plasma membrane
GO:0016327 C apicolateral plasma membrane
GO:0016328 C lateral plasma membrane
GO:0016332 P establishment or maintenance of polarity of embryonic epithelium
GO:0016333 P morphogenesis of follicular epithelium
GO:0016334 P establishment or maintenance of polarity of follicular epithelium
GO:0016335 P morphogenesis of larval imaginal disc epithelium
GO:0016336 P establishment or maintenance of polarity of larval imaginal disc epithelium
GO:0019233 P sensory perception of pain
GO:0019991 P septate junction assembly
GO:0030054 C cell junction
GO:0030154 P cell differentiation
GO:0030707 P ovarian follicle cell development
GO:0030710 P regulation of border follicle cell delamination
GO:0030714 P anterior/posterior axis specification, follicular epithelium
GO:0031594 C neuromuscular junction
GO:0035255 F ionotropic glutamate receptor binding
GO:0042058 P regulation of epidermal growth factor receptor signaling pathway
GO:0042127 P regulation of cell population proliferation
GO:0042332 P gravitaxis
GO:0042734 C presynaptic membrane
GO:0043113 P receptor clustering
GO:0043195 C terminal bouton
GO:0045167 P asymmetric protein localization involved in cell fate determination
GO:0045175 P basal protein localization
GO:0045179 C apical cortex
GO:0045196 P establishment or maintenance of neuroblast polarity
GO:0045197 P establishment or maintenance of epithelial cell apical/basal polarity
GO:0045202 C synapse
GO:0045211 C postsynaptic membrane
GO:0045475 P locomotor rhythm
GO:0045887 P positive regulation of synaptic assembly at neuromuscular junction
GO:0046037 P GMP metabolic process
GO:0046425 P regulation of receptor signaling pathway via JAK-STAT
GO:0046710 P GDP metabolic process
GO:0046956 P positive phototaxis
GO:0048471 C perinuclear region of cytoplasm
GO:0051124 P synaptic assembly at neuromuscular junction
GO:0051294 P establishment of spindle orientation
GO:0051726 P regulation of cell cycle
GO:0060581 P cell fate commitment involved in pattern specification
GO:0061174 C type I terminal bouton
GO:0061176 C type Ib terminal bouton
GO:0097120 P receptor localization to synapse
RNA-seq EntryA_ErmoMG_comp36209_c0_seq1
Sequence
(Amino Acid)
MTERRKKKSHNGFLRKVSSLFNLDTAHVPSPEMKQLQVNGIEGGNERTTGEDGYIYLSVA
LSRAGGAGLGFSIAGGSDNPHIADDPHIYVTKLIPGGAAAASQLQINDAILQVNDVNVEN
VIHAEAVDALKKAGSNVRLKIRRRATEDTLNVSQVSNKEESVEIELIKGGSGLGFSIAGG
LGNQHIPGDNGIYVTKIMAGGAAHQDGRLRVGDKLLMVKNTSDGDVNLDNVTHEDAVAAL
KATGERVLLVLVPGPRHGQPSPRTSRANTPSSAANSLRREDATDGGEEVRVVELEKGASG
LGFNIVGGEDGHGIYVSFLLAGGPAERSGTLRRGDRLLAVNDLDISHATHEQAAKALKST
GQNVKLTVVYRPQEYNKFEARINELKQHHTLLRTSQKRSLYVRALFDYDPVRDDGLPSRG
LPFRYGDILHVTNASDDEWWQARRLGQDKVDTDAIGIIPSKRRWERKQRARDRQVKFQGQ
GTPVSTSQSTLERKKKTLSFSRKFPFMKSREDGKSEDGSDQEPFMLCYTQEDANADGQDE
SVLSYETVQQLTITYTRPVIILGPLKDRINDDLISEFPDKFGSCVPHTTRPRRDYEVDGR
DYHFVASREQMERDIQNHLFIEAGQYNDNLYGTSVASVREVAEKGKHCILDVSGNAIKRL
QVAQLFPIAIFIKPKSVESIMEMNKRMTEEQAKKTYERALKMEQEFAEYFTAVVTGDTPE
EIYCKVKAVIAAESGPSVWVPRREPL
*(248 a.a.)

- SilkBase 1999-2023 -