SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_ErmoMG12342_3prime_partial:A_ErmoMG_comp36194_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)		Structural_maintenance_of_chromosomes_smc3_[Operophtera_brumata]
Ontology
GO:0000166 F nucleotide binding
GO:0000785 C chromatin
GO:0000922 C spindle pole
GO:0003674 F molecular_function
GO:0003682 F chromatin binding
GO:0005524 F ATP binding
GO:0005604 C basement membrane
GO:0005634 C nucleus
GO:0005694 C chromosome
GO:0005737 C cytoplasm
GO:0006275 P regulation of DNA replication
GO:0006281 P DNA repair
GO:0006974 P cellular response to DNA damage stimulus
GO:0007049 P cell cycle
GO:0007052 P mitotic spindle organization
GO:0007064 P mitotic sister chromatid cohesion
GO:0007067 P mitotic cell cycle
GO:0007126 P meiotic cell cycle
GO:0007165 P signal transduction
GO:0008280 C cohesin complex
GO:0016363 C nuclear matrix
GO:0030893 C meiotic cohesin complex
GO:0045502 F dynein complex binding
GO:0051276 P chromosome organization
GO:0051301 P cell division
GO:0051321 P meiotic cell cycle
RNA-seq EntryA_ErmoMG_comp36194_c0_seq1
Sequence
(Amino Acid)
MHIKQVIIQGFKSYREQIVVEPFDKRHNVVVGRNGSGKSNFFHAIQFVLSDEFSHLRPEQ
RLALLHEGTGPRVISAFVEIIFDNSDNRIPIEKDEIFLRRVIGSK
(34 a.a.)

- SilkBase 1999-2023 -