SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_ErmoMG12198_3prime_partial:A_ErmoMG_comp36147_c0_seq2
Scaffold_id
NCBI non-redundant
(nr)		Dead-box-1,_partial_[Papilio_xuthus]
Ontology
GO:0000166 F nucleotide binding
GO:0001700 P embryonic development via the syncytial blastoderm
GO:0003676 F nucleic acid binding
GO:0003682 F chromatin binding
GO:0003712 F transcription coregulator activity
GO:0003723 F RNA binding
GO:0004004 F RNA helicase activity
GO:0004386 F helicase activity
GO:0004518 F nuclease activity
GO:0004527 F exonuclease activity
GO:0005524 F ATP binding
GO:0005575 C cellular_component
GO:0005634 C nucleus
GO:0006302 P double-strand break repair
GO:0007283 P spermatogenesis
GO:0008026 F helicase activity
GO:0008143 F poly(A) binding
GO:0010501 P RNA secondary structure unwinding
GO:0016787 F hydrolase activity
GO:0032508 P DNA duplex unwinding
GO:0033677 F DNA/RNA helicase activity
GO:0042254 P ribosome biogenesis
GO:0048477 P oogenesis
GO:0090305 P nucleic acid phosphodiester bond hydrolysis
GO:1903506 P regulation of nucleic acid-templated transcription
RNA-seq EntryA_ErmoMG_comp36147_c0_seq2
Sequence
(Amino Acid)
MINVTLPDEKSNYVHRIGRVGRAERMGLAISLVSTVPEKVWYHGEWCSSRGRNCWNTNLI
DDRPKGCCMWYNEPQYLADIEDHLNITIQQIETDMKVPSNEFDGKVIYGEKRKQTGTGYQ
DHVSQMAPVVKSLQELESQAQLY
(46 a.a.)

- SilkBase 1999-2023 -