SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_ErmoMG12159_3prime_partial:A_ErmoMG_comp36138_c1_seq4
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_extended_synaptotagmin-1_[Bombyx_mori]
Ontology
GO:0005509 F calcium ion binding
GO:0005515 F protein binding
GO:0005544 F calcium-dependent phospholipid binding
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006810 P transport
GO:0006869 P lipid transport
GO:0006897 P endocytosis
GO:0008289 F lipid binding
GO:0008429 F phosphatidylethanolamine binding
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0031210 F phosphatidylcholine binding
GO:0031227 C intrinsic component of endoplasmic reticulum membrane
GO:0031234 C extrinsic component of cytoplasmic side of plasma membrane
GO:0035091 F phosphatidylinositol binding
GO:0042802 F identical protein binding
GO:0044232 C organelle membrane contact site
GO:0046872 F metal ion binding
RNA-seq EntryA_ErmoMG_comp36138_c1_seq4
Sequence
(Amino Acid)
MGIQNDDYLGRCSLDISQVVRFGRLDTWQTLQQAKHGKVQLRLSWHRLTTDVTELSRALT
ETLLIKTGDLSSAVLSVYIDSCKKLPNARVQSRPDPYLTVSVGKKSENTAVQLRTDDPVY
EIGYSF
(41 a.a.)

- SilkBase 1999-2023 -