SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_ErmoMG12043_complete:A_ErmoMG_comp36107_c0_seq2
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_tribbles_homolog_2_[Plutella_xylostella]
Ontology
GO:0000166 F nucleotide binding
GO:0004672 F protein kinase activity
GO:0004860 F protein kinase inhibitor activity
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005856 C cytoskeleton
GO:0006468 P protein phosphorylation
GO:0006469 P negative regulation of protein kinase activity
GO:0008134 F transcription factor binding
GO:0031434 F mitogen-activated protein kinase kinase binding
GO:0031625 F ubiquitin protein ligase binding
GO:0032436 P positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0043405 P regulation of MAP kinase activity
GO:0043433 P negative regulation of DNA-binding transcription factor activity
GO:0045081 P negative regulation of interleukin-10 production
GO:0045599 P negative regulation of fat cell differentiation
GO:0051443 P positive regulation of ubiquitin-protein transferase activity
GO:0055106 F ubiquitin-protein transferase regulator activity
RNA-seq EntryA_ErmoMG_comp36107_c0_seq2
Sequence
(Amino Acid)
MAETVAACHEQGIVLRDLKLRKFVFADPQRTTLKLESLEDAVVLDDPEEDLLQDKRGCPA
YVSPEILKAHRTYSGKAADMWSLGVILYTMLVGRYPFNDSEHASLFAKISRGFFVVPECL
SSRGKCLIRSLLRREAGERLSAGAVLRHPWLARDPRNELPPRAAAALDRLVPDCL
*(57 a.a.)

- SilkBase 1999-2023 -