SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_ErmoMG1203_internal:A_ErmoMG_comp19160_c1_seq1
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_ubiquitin_conjugation_factor_E4_B_[Plutella_xylostella]
Ontology
GO:0000151 C ubiquitin ligase complex
GO:0000209 P protein polyubiquitination
GO:0003222 P ventricular trabecula myocardium morphogenesis
GO:0004842 F ubiquitin-protein transferase activity
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0006511 P ubiquitin-dependent protein catabolic process
GO:0006513 P protein monoubiquitination
GO:0008626 P granzyme-mediated apoptotic signaling pathway
GO:0009411 P response to UV
GO:0016567 P protein ubiquitination
GO:0016874 F ligase activity
GO:0019899 F enzyme binding
GO:0031175 P neuron projection development
GO:0034450 F ubiquitin-ubiquitin ligase activity
GO:0034976 P response to endoplasmic reticulum stress
GO:0042787 P ubiquitin-dependent protein catabolic process
GO:0043161 P proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0044257 P cellular protein catabolic process
GO:0051117 F ATPase binding
GO:0051865 P protein autoubiquitination
GO:0061630 F ubiquitin protein ligase activity
RNA-seq EntryA_ErmoMG_comp19160_c1_seq1
Sequence
(Amino Acid)
ADGIDPLSQKLTAIIETSKNLNEENTEDALPSSGSAETETDKPECPTPALPIQKTMPTQG
LAVSYLLRFYNNVNLYEREHPKKSSEPPLSDLLQNLRTLLVNHLVLVLQGK
(36 a.a.)

- SilkBase 1999-2023 -