SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_ErmoMG12019_complete:A_ErmoMG_comp36099_c0_seq3
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_vacuolar_protein_sorting-associated_protein_28_homolog_[Bombyx_mori]
Ontology
GO:0000813 C ESCRT I complex
GO:0005515 F protein binding
GO:0005768 C endosome
GO:0006810 P transport
GO:0006914 P autophagy
GO:0007291 P sperm individualization
GO:0007293 P germarium-derived egg chamber formation
GO:0008593 P regulation of Notch signaling pathway
GO:0009792 P embryo development ending in birth or egg hatching
GO:0010796 P regulation of multivesicular body size
GO:0015031 P protein transport
GO:0030036 P actin cytoskeleton organization
GO:0030713 P ovarian follicle cell stalk formation
GO:0032403 F protein-containing complex binding
GO:0032509 P endosome transport via multivesicular body sorting pathway
GO:0042059 P negative regulation of epidermal growth factor receptor signaling pathway
GO:0043162 P ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway
GO:0043328 P protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway
GO:0044130 P obsolete negative regulation of growth of symbiont in host
GO:0048749 P compound eye development
GO:0060429 P epithelium development
GO:0097352 P autophagosome maturation
RNA-seq EntryA_ErmoMG_comp36099_c0_seq3
Sequence
(Amino Acid)
MQDTRPELYEEVKLYKNAREREKHDNMAELYAVVCTLQHLEKAYMRDCVRAQEYTAACSR
LLVQYKVAFKQVQADEFPNIEAFVAKYRLDCPAALERIKENKPNLIKDDKGNTNKYIAEI
VSLFITLMDKLRLEFRAMDMIQPELRDLRDTMDRLSMLPDDFEGKEKVQEWLDKLSEMSA
SDELSESQVRQLVFDLESSYGAFNKFLHKE
*(69 a.a.)

- SilkBase 1999-2023 -