SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_ErmoMG1191_5prime_partial:A_ErmoMG_comp19139_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_aldose_reductase-like_[Amyelois_transitella]
Ontology
GO:0001894 P tissue homeostasis
GO:0004032 F alditol:NADP+ 1-oxidoreductase activity
GO:0004033 F aldo-keto reductase (NADP) activity
GO:0005615 C extracellular space
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005975 P carbohydrate metabolic process
GO:0005996 P monosaccharide metabolic process
GO:0006061 P sorbitol biosynthetic process
GO:0006700 P C21-steroid hormone biosynthetic process
GO:0006950 P response to stress
GO:0009055 F electron transfer activity
GO:0009414 P response to water deprivation
GO:0010033 P response to organic substance
GO:0016491 F oxidoreductase activity
GO:0018931 P naphthalene catabolic process
GO:0031098 P stress-activated protein kinase signaling cascade
GO:0032838 C plasma membrane bounded cell projection cytoplasm
GO:0033010 C paranodal junction
GO:0042415 P norepinephrine metabolic process
GO:0042629 C mast cell granule
GO:0043220 C Schmidt-Lanterman incisure
GO:0043795 F glyceraldehyde oxidoreductase activity
GO:0044597 P daunorubicin metabolic process
GO:0044598 P doxorubicin metabolic process
GO:0046370 P fructose biosynthetic process
GO:0046427 P positive regulation of receptor signaling pathway via JAK-STAT
GO:0048471 C perinuclear region of cytoplasm
GO:0048661 P positive regulation of smooth muscle cell proliferation
GO:0055114 P obsolete oxidation-reduction process
GO:0060135 P maternal process involved in female pregnancy
GO:0070062 C extracellular exosome
GO:0070301 P cellular response to hydrogen peroxide
GO:0072061 P inner medullary collecting duct development
GO:0097066 P response to thyroid hormone
GO:0097238 P cellular response to methylglyoxal
GO:0097454 C Schwann cell microvillus
GO:1901653 P cellular response to peptide
RNA-seq EntryA_ErmoMG_comp19139_c0_seq1
Sequence
(Amino Acid)
ADTPRAHFNNGHTCPVIGLGTWKSKPGEVTQAVKDAIDIGYRHIDCAHVYGNEKEVGEAL
KAKFDEGKVKREDMFITSKLWCTFHRPDLVEGAVRSSLQDLGLDYLDLYLVHWPQAYQEG
GSLFPLDENKKFIPSPVGVVETWGAMESLVEKGLVRTIGLSNFNKRQIERVLEVAKIKPA
VLQIEVHPYLNQQPLVSYCQSVGLVVTAYSPLGSPDRPWAKPGDPSLLEDPRLTDIARSL
GRTVPQILIRYAIDRGLVVIPKSVTRSRIQHNYDVFGFRLSEEQLAAVARLECGGRLCTM
GDTHHPDYPFHDEY
*(104 a.a.)

- SilkBase 1999-2023 -