SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_ErmoMG11900_internal:A_ErmoMG_comp36052_c1_seq1
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_survivin-1_isoform_X1_[Bombyx_mori]
Ontology
GO:0000922 C spindle pole
GO:0001890 P placenta development
GO:0004842 F ubiquitin-protein transferase activity
GO:0004869 F cysteine-type endopeptidase inhibitor activity
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005768 C endosome
GO:0005794 C Golgi apparatus
GO:0005802 C trans-Golgi network
GO:0005815 C microtubule organizing center
GO:0005856 C cytoskeleton
GO:0006468 P protein phosphorylation
GO:0006915 P apoptotic process
GO:0007049 P cell cycle
GO:0007067 P mitotic cell cycle
GO:0008284 P positive regulation of cell population proliferation
GO:0010466 P negative regulation of peptidase activity
GO:0010951 P negative regulation of endopeptidase activity
GO:0016020 C membrane
GO:0016567 P protein ubiquitination
GO:0016874 F ligase activity
GO:0030414 F peptidase inhibitor activity
GO:0030496 C midbody
GO:0032465 P regulation of cytokinesis
GO:0042127 P regulation of cell population proliferation
GO:0043066 P negative regulation of apoptotic process
GO:0051301 P cell division
GO:0060711 P labyrinthine layer development
GO:0060712 P spongiotrophoblast layer development
GO:0061631 F ubiquitin conjugating enzyme activity
GO:2001237 P negative regulation of extrinsic apoptotic signaling pathway
RNA-seq EntryA_ErmoMG_comp36052_c1_seq1
Sequence
(Amino Acid)
TALLQVLASYINPCEKWPPEEGQEPSPDTESESNSAETQSEECSDLPTDFIDLIANSSLV
PAICSYLRNDSVLDMSRHIPLYVCVLRCARGLVALRSARLTAALRPLPRLLAQMSRTTNS
YATKLKMSKKTIFGKMTYSQRFCPATNSELSEEDEGLASLIADIQATSAMMYSGNVGGSE
EARG
(60 a.a.)

- SilkBase 1999-2023 -