SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_ErmoMG1178_3prime_partial:A_ErmoMG_comp19100_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
hypothetical_protein_KGM_09453_[Danaus_plexippus]
Ontology
GO:0005085 F guanyl-nucleotide exchange factor activity
GO:0005089 F guanyl-nucleotide exchange factor activity
GO:0005509 F calcium ion binding
GO:0005515 F protein binding
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0005905 C clathrin-coated pit
GO:0006897 P endocytosis
GO:0007264 P small GTPase mediated signal transduction
GO:0012505 C endomembrane system
GO:0016020 C membrane
GO:0019209 F kinase activator activity
GO:0030027 C lamellipodium
GO:0030054 C cell junction
GO:0030139 C endocytic vesicle
GO:0032947 F molecular adaptor activity
GO:0035023 P regulation of Rho protein signal transduction
GO:0035556 P intracellular signal transduction
GO:0042327 P positive regulation of phosphorylation
GO:0042995 C cell projection
GO:0043005 C neuron projection
GO:0043524 P negative regulation of neuron apoptotic process
GO:0043547 P positive regulation of GTPase activity
GO:0045202 C synapse
GO:0046872 F metal ion binding
GO:0048013 P ephrin receptor signaling pathway
GO:0051897 P positive regulation of protein kinase B signaling
GO:0070064 F proline-rich region binding
RNA-seq EntryA_ErmoMG_comp19100_c0_seq1
Sequence
(Amino Acid)
MADPWMVQAHEHAKFAEHFRNLGPVNGNLTGEQAKRFMLQSQLPPPVLGQIWSLADTNAD
GKLDLKEFSIACKIINLKLRGVEVPKTLPPSLIASLTPTGAPKPQFT
(34 a.a.)

- SilkBase 1999-2023 -