SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_ErmoMG11667_complete:A_ErmoMG_comp35994_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_NEDD4_family-interacting_protein_2_[Bombyx_mori]
Ontology
GO:0000139 C Golgi membrane
GO:0002761 P regulation of myeloid leukocyte differentiation
GO:0002829 P negative regulation of type 2 immune response
GO:0004871 F obsolete signal transducer activity
GO:0005515 F protein binding
GO:0005576 C extracellular region
GO:0005768 C endosome
GO:0005794 C Golgi apparatus
GO:0005938 C cell cortex
GO:0006879 P cellular iron ion homeostasis
GO:0007034 P vacuolar transport
GO:0007165 P signal transduction
GO:0010008 C endosome membrane
GO:0010629 P negative regulation of gene expression
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0030001 P metal ion transport
GO:0031398 P positive regulation of protein ubiquitination
GO:0032410 P negative regulation of transporter activity
GO:0032713 P negative regulation of interleukin-4 production
GO:0042130 P negative regulation of T cell proliferation
GO:0043123 P positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0043162 P ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway
GO:0045619 P regulation of lymphocyte differentiation
GO:0045732 P positive regulation of protein catabolic process
GO:0048294 P negative regulation of isotype switching to IgE isotypes
GO:0048302 P regulation of isotype switching to IgG isotypes
GO:0048471 C perinuclear region of cytoplasm
GO:0050728 P negative regulation of inflammatory response
GO:0051224 P negative regulation of protein transport
RNA-seq EntryA_ErmoMG_comp35994_c0_seq1
Sequence
(Amino Acid)
MLQNNPRLENIHPPQLTVILPSHLDTNITPNYIDMNLSDIPPPQDDFSAPPPYDVAANTK
LPTYEEVQREKQMEGEAPMGRLPSHQPTFTAFVTVETADGVSEPLDHENSLLGTDVMFMT
SFLVAFLFNWIGFLLLMCFCHTVASRYGALAGFGLSLAKWTLIVKQSTELASHDNSWLWW
LMMAFGILICLRAIIQYLNIKRGWRLLSGTAQERLLFFY
*(72 a.a.)

- SilkBase 1999-2023 -