SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_ErmoMG11643_complete:A_ErmoMG_comp35979_c0_seq3
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_aryl_hydrocarbon_receptor_nuclear_translocator_homolog_isoform_X2_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000981 F DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001077 F DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0003705 F DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0005634 C nucleus
GO:0005667 C transcription regulator complex
GO:0005737 C cytoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0006366 P transcription by RNA polymerase II
GO:0007417 P central nervous system development
GO:0007420 P brain development
GO:0007422 P peripheral nervous system development
GO:0007424 P open tracheal system development
GO:0007425 P epithelial cell fate determination, open tracheal system
GO:0007517 P muscle organ development
GO:0008347 P glial cell migration
GO:0017022 F myosin binding
GO:0032869 P cellular response to insulin stimulus
GO:0043234 C protein-containing complex
GO:0043565 F sequence-specific DNA binding
GO:0045676 P regulation of R7 cell differentiation
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046982 F protein heterodimerization activity
GO:0046983 F protein dimerization activity
GO:0048477 P oogenesis
GO:0048666 P neuron development
GO:0048813 P dendrite morphogenesis
GO:0060173 P limb development
GO:0071456 P cellular response to hypoxia
RNA-seq EntryA_ErmoMG_comp35979_c0_seq3
Sequence
(Amino Acid)
MSAVAPTIPGADPAKDLQKRRAGSVGSDEDDGSGGKYTRMEEDNIQDKERFASRENHCEI
ERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMAVAHMKALRGTGNTSTDGTYKPS
FLTDQELKHLILEAADGFLFVVSCDTGRIIYVSDSIAPVLNYSQGEWYSSCLYDQVHPDD
VEKVREQLSTQEPQNTGRILDLKTGTVKKEGHQSSMRQVMGSRRGFICRMRVGGTAEGAH
LGRLRARNSLGPSHDGHNYAVVHCTGYIKKLASNR
*(91 a.a.)

- SilkBase 1999-2023 -