SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_ErmoMG11573_complete:A_ErmoMG_comp35955_c1_seq1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_integrin_beta_subunit_1_isoform_X1_[Bombyx_mori]
Ontology
GO:0003344 P pericardium morphogenesis
GO:0004872 F signaling receptor activity
GO:0005515 F protein binding
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0005925 C focal adhesion
GO:0005927 C muscle tendon junction
GO:0006930 P substrate-dependent cell migration, cell extension
GO:0007015 P actin filament organization
GO:0007155 P cell adhesion
GO:0007157 P heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules
GO:0007160 P cell-matrix adhesion
GO:0007229 P integrin-mediated signaling pathway
GO:0007275 P multicellular organism development
GO:0007298 P border follicle cell migration
GO:0007377 P germ-band extension
GO:0007391 P dorsal closure
GO:0007411 P axon guidance
GO:0007417 P central nervous system development
GO:0007426 P tracheal outgrowth, open tracheal system
GO:0007427 P epithelial cell migration, open tracheal system
GO:0007431 P salivary gland development
GO:0007475 P apposition of dorsal and ventral imaginal disc-derived wing surfaces
GO:0007494 P midgut development
GO:0007508 P larval heart development
GO:0007517 P muscle organ development
GO:0007601 P visual perception
GO:0007608 P sensory perception of smell
GO:0007610 P behavior
GO:0007629 P flight behavior
GO:0008305 C integrin complex
GO:0008340 P determination of adult lifespan
GO:0008360 P regulation of cell shape
GO:0009925 C basal plasma membrane
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016203 P muscle attachment
GO:0016324 C apical plasma membrane
GO:0016328 C lateral plasma membrane
GO:0016339 P calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules
GO:0016340 P calcium-dependent cell-matrix adhesion
GO:0016477 P cell migration
GO:0021551 P central nervous system morphogenesis
GO:0030336 P negative regulation of cell migration
GO:0030718 P germ-line stem cell population maintenance
GO:0031252 C cell leading edge
GO:0031589 P cell-substrate adhesion
GO:0033627 P cell adhesion mediated by integrin
GO:0034446 P substrate adhesion-dependent cell spreading
GO:0035001 P dorsal trunk growth, open tracheal system
GO:0035099 P hemocyte migration
GO:0035160 P maintenance of epithelial integrity, open tracheal system
GO:0043034 C costamere
GO:0045214 P sarcomere organization
GO:0046982 F protein heterodimerization activity
GO:0048803 P imaginal disc-derived male genitalia morphogenesis
GO:0050839 F cell adhesion molecule binding
GO:0050896 P response to stimulus
GO:0051492 P regulation of stress fiber assembly
GO:1990430 F extracellular matrix protein binding
RNA-seq EntryA_ErmoMG_comp35955_c1_seq1
Sequence
(Amino Acid)
MYIQRTSLLLVSVWASLLVVCSTQHAEQLLAQNPCSSKTTCSECARTPSCAWCFADEFNG
PRCFNPAMEGGTGGCDEAFIFNPDNQLFVLSNKELSRAKGRMGSAASGSGSAASGSASGG
GASGGFGSAAVGAGAADAADNIVQMKPQSVKLQMRMNQMQKLTFSYSRAQDYPVDLYYLM
DLSASMRNDKDKLSALGSLLSATMRNITSNFRIGFGSFVDKVVL
*(74 a.a.)

- SilkBase 1999-2023 -