SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_ErmoMG11557_internal:A_ErmoMG_comp35948_c0_seq4
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_adenylate_cyclase_type_6_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0001973 P G protein-coupled adenosine receptor signaling pathway
GO:0003091 P renal water homeostasis
GO:0004016 F adenylate cyclase activity
GO:0005524 F ATP binding
GO:0005622 C intracellular anatomical structure
GO:0005886 C plasma membrane
GO:0005929 C cilium
GO:0006171 P cAMP biosynthetic process
GO:0007189 P adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0007190 P activation of adenylate cyclase activity
GO:0007191 P adenylate cyclase-activating dopamine receptor signaling pathway
GO:0007193 P adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway
GO:0007195 P adenylate cyclase-inhibiting dopamine receptor signaling pathway
GO:0007204 P positive regulation of cytosolic calcium ion concentration
GO:0007626 P locomotory behavior
GO:0008179 F adenylate cyclase binding
GO:0009190 P cyclic nucleotide biosynthetic process
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016829 F lyase activity
GO:0016849 F phosphorus-oxygen lyase activity
GO:0019933 P cAMP-mediated signaling
GO:0034199 P activation of protein kinase A activity
GO:0035556 P intracellular signal transduction
GO:0042995 C cell projection
GO:0046872 F metal ion binding
GO:0046982 F protein heterodimerization activity
GO:0050885 P neuromuscular process controlling balance
GO:0061178 P regulation of insulin secretion involved in cellular response to glucose stimulus
GO:0071377 P cellular response to glucagon stimulus
GO:0072372 C cilium
GO:1904322 P cellular response to forskolin
RNA-seq EntryA_ErmoMG_comp35948_c0_seq4
Sequence
(Amino Acid)
DQFDAQELYHEQCESVCVMFASIPNFSEFYVELEGNNEGVECLRLLNEIIADFDEILAED
NFKYIEKIKSTGATYMAASGLTNTTRDLVGYRHVTAMADYALRLREQLQYVNEHSFNCFR
IRIGINIGPVVAGVIGARKPQYDIWGNAVNVASRMDSTGLLDHIQVPTYTLHFSWRILVF
(59 a.a.)

- SilkBase 1999-2023 -