SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_ErmoMG11554_internal:A_ErmoMG_comp35948_c0_seq2
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_adenylate_cyclase_type_6_[Bombyx_mori]
Ontology
GO:0000149 F SNARE binding
GO:0000166 F nucleotide binding
GO:0003091 P renal water homeostasis
GO:0004016 F adenylate cyclase activity
GO:0005102 F signaling receptor binding
GO:0005524 F ATP binding
GO:0005768 C endosome
GO:0005886 C plasma membrane
GO:0005929 C cilium
GO:0006171 P cAMP biosynthetic process
GO:0007189 P adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0007193 P adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway
GO:0008294 F calcium- and calmodulin-responsive adenylate cyclase activity
GO:0009190 P cyclic nucleotide biosynthetic process
GO:0010977 P negative regulation of neuron projection development
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016829 F lyase activity
GO:0016849 F phosphorus-oxygen lyase activity
GO:0019901 F protein kinase binding
GO:0019933 P cAMP-mediated signaling
GO:0031226 C intrinsic component of plasma membrane
GO:0031528 C microvillus membrane
GO:0035556 P intracellular signal transduction
GO:0035811 P negative regulation of urine volume
GO:0042383 C sarcolemma
GO:0042995 C cell projection
GO:0045121 C membrane raft
GO:0046872 F metal ion binding
GO:0072660 P maintenance of protein location in plasma membrane
GO:1904117 P cellular response to vasopressin
GO:1904322 P cellular response to forskolin
RNA-seq EntryA_ErmoMG_comp35948_c0_seq2
Sequence
(Amino Acid)
QLTLIAMFLCAVHQILITMVKMLLLLVVSITYVVVTTQEHLYYQNHFYDYQHRCGLDWNQ
QWTNIAIALGATVALLLHSQQTESTYRLDFIWKLQANEEKEDMEHLQAYNRKLLANILPE
HVAQHFLNSDKNIDQFDAQEL
(46 a.a.)

- SilkBase 1999-2023 -