| Name | O_ErmoMG11509_5prime_partial:A_ErmoMG_comp35937_c0_seq3 |
| Scaffold_id | |
NCBI non-redundant (nr) | PREDICTED:_protein_Gawky_[Bombyx_mori] |
| Ontology |
| GO:0000166 |
F |
nucleotide binding |
| GO:0000184 |
P |
nuclear-transcribed mRNA catabolic process, nonsense-mediated decay |
| GO:0000932 |
C |
P-body |
| GO:0001700 |
P |
embryonic development via the syncytial blastoderm |
| GO:0003723 |
F |
RNA binding |
| GO:0005515 |
F |
protein binding |
| GO:0005737 |
C |
cytoplasm |
| GO:0006402 |
P |
mRNA catabolic process |
| GO:0006417 |
P |
regulation of translation |
| GO:0007275 |
P |
multicellular organism development |
| GO:0031047 |
P |
gene silencing by RNA |
| GO:0032880 |
P |
regulation of protein localization |
| GO:0035195 |
P |
gene silencing by miRNA |
| GO:0045475 |
P |
locomotor rhythm |
|
| RNA-seq Entry | A_ErmoMG_comp35937_c0_seq3 |
Sequence (Amino Acid) | LCVQHGPLLNFHLYLNQGLALARYSTREEAAKAQMALNNCVLSNTTIFAESPAESEVQLM
LQHLGSGGGGAWRGSAQSKDWSGYNSLWPDQHDQRATPSSLNSFLPPDLLGGESI
*(37 a.a.) |